Dbfetch

ID   U89428; SV 1; linear; transcribed RNA; STD; MUS; 437 BP.
XX
AC   U89428;
XX
DT   24-SEP-1998 (Rel. 57, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus strain BALB/c Fig1 protein precursor (Fig1ps) gene, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-437
RX   DOI; 10.1016/S0161-5890(98)00031-5.
RX   PUBMED; 9798653.
RA   Chu C.C., Paul W.E.;
RT   "Expressed genes in interleukin-4 treated B cells identified by cDNA
RT   representational difference analysis";
RL   Mol. Immunol. 35(8):487-502(1998).
XX
RN   [2]
RP   1-437
RA   Chu C.C., Paul W.E.;
RT   ;
RL   Submitted (13-FEB-1997) to the INSDC.
RL   Lab. of Immunology, NIAID, Building 10, Room 11N311, Bethesda, MD
RL   20892-1892, USA
XX
DR   MD5; efa0212ab35df771907206b6045060ba.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..437
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="transcribed RNA"
FT                   /cell_type="B cells treated with LPS and IL-4 for 12 and 36
FT                   hours"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   exon            <1..202
FT                   /gene="Fig1ps"
FT                   /number=2
FT   CDS             <1..>202
FT                   /codon_start=2
FT                   /gene="Fig1ps"
FT                   /product="Fig1 protein precursor"
FT                   /note="similar to some flavoproteins, most specifically to
FT                   monoamine oxidases; interleukin-4 induced gene-1"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAC36534.1"
FT                   /translation="ILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPEKLG
FT                   YNLNNRERGHSPEDIYQMALNK"
FT   precursor_RNA   <1..>437
FT                   /gene="Fig1ps"
FT   intron          203..>437
FT                   /gene="Fig1ps"
FT                   /number=2
XX
SQ   Sequence 437 BP; 104 A; 136 C; 103 G; 94 T; 0 other;
     gatcttgcac aagctctgca ggaccctggg cctcaacctg actcagttca cacagtatga        60
     tgagaacacg tggacggagg tgcataatgt gaagctgcga aactatgtgg tggagaagat       120
     gccagaaaag ctgggctaca acctgaacaa cagggaaagg ggccattccc cagaggacat       180
     ctaccagatg gcactcaaca aggtggccac cggctttcct gcagagctca gccctgcccc       240
     caagagtctt gtgtctacta ctatcacgtc tgctgatggc tagcgggtgt tttctccatc       300
     cctccagctc acccactact gtagcccctg gcactcactc ccaggaccct ccagcaacac       360
     tgctactctg tgtccccatc tgcttgactc ggacagtgct gtcagacatc accctctttt       420
     cgtgtcccaa aaggatc                                                      437
//