Dbfetch

ID   U89269; SV 1; linear; mRNA; STD; MUS; 1850 BP.
XX
AC   U89269;
XX
DT   13-MAR-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus preprodipeptidyl peptidase I mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1850
RX   DOI; 10.1074/jbc.272.16.10695.
RX   PUBMED; 9099719.
RA   Pham C.T.N., Armstrong R.J., Zimonjic D.B., Popescu N.C., Payan D.G.,
RA   Ley T.J.;
RT   "Molecular cloning, chromosomal localization, and expression of murine
RT   dipeptidyl peptidase I";
RL   J Biol Chem 272(16):10695-10703(1997).
XX
RN   [2]
RP   1-1850
RA   Pham C.T.N., Armstrong R.J., Zimonjic D.B., Popescu N.C., Payan D.G.,
RA   Ley T.J.;
RT   ;
RL   Submitted (10-FEB-1997) to the INSDC.
RL   Bone Marrow Transplantation and Stem Cell Biology, Washington University
RL   School of Medicine, 660 South Euclid Avenue, Box 8007, St. Louis, MO 63110,
RL   USA
XX
DR   MD5; a738a794a6e7107e43466cc3e1f4ea54.
DR   Ensembl-Gn; ENSMUSG00000030560; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032492; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032466; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032192; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032975; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031519; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032159; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032311; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032267; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032301; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032997; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031237; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031636; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032779; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084900; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084966; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084918; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0084512; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0085445; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085025; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0084449; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0084640; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0084495; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0084669; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0084540; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085726; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0084450; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0083562; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1850
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7D3-E1.1"
FT                   /strain="129/SvJ"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   exon            <69..240
FT   CDS             69..1457
FT                   /codon_start=1
FT                   /product="preprodipeptidyl peptidase I"
FT                   /note="cathepsin C"
FT                   /db_xref="GOA:P97821"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR014882"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="InterPro:IPR036496"
FT                   /db_xref="MGI:MGI:109553"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97821"
FT                   /protein_id="AAB49457.1"
FT                   /translation="MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGP
FT                   RSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAF
FT                   FKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKVESHIEKVNMNAAHLGGLQERY
FT                   SERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDE
FT                   IQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPI
FT                   LSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYY
FT                   SSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPF
FT                   ELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIP
FT                   IPKL"
FT   exon            241..386
FT   exon            387..553
FT   exon            554..706
FT   exon            707..822
FT   exon            823..1002
FT   exon            1003..>1457
XX
SQ   Sequence 1850 BP; 506 A; 412 C; 424 G; 508 T; 0 other;
     gactgccatc gagtggtgtt ccagttgaac ttgctttctc tgccatctgc tccgcgggcg        60
     ccgtcagcat gggtccctgg acccactcct tgcgcgccgt cctgctgctg gtgcttttgg       120
     gagtctgcac cgtgcgctcc gacactcctg ccaactgcac ctaccctgat ctgctgggca       180
     cctgggtgtt ccaggtgggc cctagaagtt cccgaagcga cattaactgc tcggtgatgg       240
     aagcaacaga agaaaaggta gtggtacacc ttaagaagtt ggatactgcc tacgacgagc       300
     tgggcaattc cgggcatttt accctcattt acaaccaagg cttcgagatt gtgttgaatg       360
     actacaaatg gtttgcgttt ttcaagtatg aagtcagagg ccacacagct atcagttact       420
     gccatgagac catgactggg tgggtccatg atgtgctggg ccggaactgg gcttgctttg       480
     ttggcaagaa ggtggaaagt cacattgaga aggttaatat gaatgcagca catcttggag       540
     gtctccagga aagatattct gaaagactct acactcacaa ccacaacttt gtgaaggcca       600
     tcaataccgt tcagaagtct tggactgcaa ctgcatataa ggaatatgag aaaatgagcc       660
     tgcgagatct gataaggaga agtggccaca gccaaaggat cccaaggccc aaacctgccc       720
     cgatgactga tgaaatacag caacaaattt taaatttgcc agaatcttgg gactggagaa       780
     acgtccaagg cgtcaattat gttagccctg ttcgaaacca agaatcttgt ggaagctgct       840
     actcatttgc ctctatgggt atgctagaag caagaattcg tatattaacc aacaattctc       900
     agacaccaat cctgagtcct caggaggttg tatcttgcag cccctatgcc caaggttgtg       960
     atggtggatt cccatacctc attgcaggga agtatgccca agattttggg gtggtggaag      1020
     aaagctgctt tccctacaca gccaaagatt ctccatgcaa accaagggag aattgcctcc      1080
     gttactattc ttctgactac tactatgtgg gtggtttcta tggtggctgc aatgaagccc      1140
     tgatgaagct tgagctggtc aaacatggac ccatggcagt tgcctttgaa gtccacgatg      1200
     acttcctaca ctaccacagt ggaatctatc accacactgg gctgagtgac cctttcaacc      1260
     ccttcgagct gacaaatcat gctgttttgc ttgtgggcta tggaagagat ccagttactg      1320
     ggatagaata ctggattata aagaacagct ggggctctaa ctggggggag agtggctact      1380
     tccgtatccg cagaggaact gatgaatgtg caattgagag tatagccgtg gcggccatac      1440
     cgattcctaa attataggac atagctccca gtgttacata cgggtcttta tcactcacag      1500
     agtgatttag tcacatgctg aagacttttt cagagcaata tcagaagctt accactaagc      1560
     atctttaaag aattttgtct ttgaacttaa aaccatcctt gatttttttc ttttaatatc      1620
     ttccccatca actactgaac tacttttctt tttaaagtac ttggttaagt aatactttta      1680
     tgagcagtgg ttcagttgtc caatattttt tgcaggtcat ctacaatgca accagatgtt      1740
     tcagttctaa aaatctatgt aaaagtacaa gctcgttttt aaattatgtt agtcacacga      1800
     aaacatggca aaaaaattag ttaaattttt tacaaagagt ttaaataaat                 1850
//