Dbfetch

ID   U88568; SV 1; linear; mRNA; STD; MUS; 2540 BP.
XX
AC   U88568;
XX
DT   03-JUN-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus secreted frizzled related protein sFRP-3 (Sfrp3) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2540
RX   DOI; 10.1073/pnas.94.7.2859.
RX   PUBMED; 9096311.
RA   Rattner A., Hsieh J.C., Smallwood P.M., Gilbert D.J., Copeland N.G.,
RA   Jenkins N.A., Nathans J.;
RT   "A family of secreted proteins contains homology to the cysteine-rich
RT   ligand-binding domain of frizzled receptors";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(7):2859-2863(1997).
XX
RN   [2]
RP   1-2540
RA   Rattner A., Hsieh J.-C., Smallwood P.M., Gilbert D.J., Copeland N.G.,
RA   Jenkins N.A., Nathans J.;
RT   ;
RL   Submitted (05-FEB-1997) to the INSDC.
RL   Molecular Biology and Genetics, HHMI/Johns Hopkins University School of
RL   Medicine, 725 North Wolfe Street, PCTB 805, Baltimore, MD 21205
XX
DR   MD5; 4b8eba33af2ca0b7b0530f4f285a7920.
DR   Ensembl-Gn; ENSMUSG00000027004; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025857; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0026303; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025078; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025597; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025728; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025816; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025721; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024821; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025147; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000028389; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0055555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0055588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0055544; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0055521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0055247; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0056007; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0055453; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0055202; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0055305; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0055265; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0055405; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0055255; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0056152; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0055052; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0054520; mus_musculus_wsbeij.
DR   EuropePMC; PMC20287; 9096311.
DR   EuropePMC; PMC4540142; 25987545.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2540
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="near Sfpi1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             365..1336
FT                   /codon_start=1
FT                   /gene="Sfrp3"
FT                   /product="secreted frizzled related protein sFRP-3"
FT                   /db_xref="GOA:P97401"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026556"
FT                   /db_xref="MGI:MGI:892032"
FT                   /db_xref="PDB:1IJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97401"
FT                   /protein_id="AAC53147.1"
FT                   /translation="MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKS
FT                   LPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEP
FT                   IKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPM
FT                   DSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEI
FT                   LKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDR
FT                   LGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPARS"
XX
SQ   Sequence 2540 BP; 638 A; 604 C; 626 G; 670 T; 2 other;
     gaattcggca cgagctgaat ttgacttttg tttttatttc tctctggctt cctcttctgc        60
     cccctcatct gattgatgtg ctaaggctga tgtctctgcc agagcgagag gaataaatag       120
     atgctgcctc gcctagaggc ttagacgctt gggaagagca gccggcgcac gagcgaccgg       180
     gctccgccaa gctagtggac cggacctggg agcacttgga tccaagagaa ctgtgattgt       240
     cccaggggtg ggggcagctc cccaggtcgt tgggatcacc cctcggaacc gcagggggag       300
     acttcggaac gaaagtgtct cccgcgtccg tcgctcgtgc gccctgcccc atcctgctgg       360
     gaccatggtc tgctgcggcc cgggacggat gctgctagga tgggccgggt tgctagtcct       420
     ggctgctctc tgcctgctcc aggtgcccgg agctcaggct gcagcctgtg agcctgtccg       480
     catcccgctg tgcaagtccc ttccctggaa catgaccaag atgcccaacc acctgcacca       540
     cagcacccag gctaacgcca tcctggccat ggaacagttc gaagggctgc tgggcaccca       600
     ctgcagcccg gatcttctct tcttcctctg tgcaatgtac gcacccattt gcaccatcga       660
     cttccagcac gagcccatca agccctgcaa gtctgtgtgt gagcgcgccc gacagggctg       720
     cgagcccatt ctcatcaagt accgccactc gtggccggaa agcttggcct gcgacgagct       780
     gccggtgtac gaccgcggcg tgtgcatctc tcctgaggcc atcgtcaccg cggacggagc       840
     ggattttcct atggattcaa gtactggaca ctgcagaggg gcaagcagcg aacgttgcaa       900
     atgtaagcct gtcagagcta cacagaagac ctatttccgg aacaattaca actatgtcat       960
     ccgggctaaa gttaaagagg taaagatgaa atgtcatgat gtgaccgccg ttgtggaagt      1020
     gaaggaaatt ctaaaggcat cactggtaaa cattccaagg gacaccgtca atctttatac      1080
     cacctctggc tgcctctgtc ctccacttac tgtcaatgag gaatatgtca tcatgggcta      1140
     tgaagacgag gaacgttcca ggttactctt ggtagaaggc tctatagctg agaagtggaa      1200
     ggatcggctt ggtaagaaag tcaagcgctg ggatatgaaa ctccgacacc ttggactggg      1260
     taaaactgat gctagcgatt ccactcagaa tcagaagtct ggcaggaact ctaatccccg      1320
     gccagcacgc agctaaatcc tgaaatgtaa aaggccacac ccacggactc ccttctaaga      1380
     ctggcgctgc tggactaaca aaggaaaacg cacagttgtg ctcgtgaccg attgtttacc      1440
     gcagacaccg cgtggctacc gaagttactt ccggtcccct ttctcctgct tcttaatggc      1500
     ctggggttag atcctttaat atgttatata ttctgtttca tcaatcacgt ggggactgtt      1560
     cttttgcaac cagaatagta aattaaatat gttgatgcta aggtttctgt actggactcc      1620
     ctgggtttaa tttggtgttc tgtaccctga ttgagaatgc aatgtttcat gtaaagagag      1680
     aatcctggtc atatctcaag aactagatat tgctgtaaga cagcctctgc tgctgcgctt      1740
     atagtcttgt gtttgtacct gtttggccat ttccctcatg ctgtgaaagt tatacatgtt      1800
     tataaaggta gaacggcatt ttgaaatcag acactgcaca agcagagtag cccaacacca      1860
     ggaagcattt atgaggaaac gccacacagc atgacttatt ttcaagattg gcaggcagca      1920
     aaataaatag tgttgggagc caagaaaaga atattttgcc tggttaaggg gcacactgga      1980
     atcagtagcc ttgagccatt aacagcagtg ttcttctggc acgtttttga tttgttcata      2040
     aatgtattca cgagcattag agatgaactt ataactagac atctgttgtt atcactatag      2100
     ctctgcttcc ttctaaatca aacccattgt tggatgctcc ctctccattc ataaataaat      2160
     ttggcttgct ggtattggcc aggaaaagaa agtattaaag tatgcatgca tgtgcaccag      2220
     ggtgttattt aacagaggta tgtaactcta taaaagacta taatttacag gacacggaaa      2280
     tgtgcacatt tgtttacttt ttttcttcct tttgctttgg gcttgtgatt ttggtttttg      2340
     gtgtgtttat gtctgtattt tggggggtgg gtaggtttaa nccattgcac attcaagttg      2400
     nactagatta gagtagacta ggctcattgg cctagacatt atgatttgaa tttgtgttgt      2460
     ttaatgctcc atcaagatgt ctaataaaag gaatatggtt gtcaacagag acgacaacac      2520
     ccaaaaaaaa aaaaaaaaaa                                                  2540
//