Dbfetch

ID   U86587; SV 1; linear; mRNA; STD; MUS; 3132 BP.
XX
AC   U86587;
XX
DT   26-AUG-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus phosphatidylinositol 3-kinase catalytic subunit p110 delta
DE   mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3132
RX   DOI; 10.1074/jbc.272.31.19236.
RX   PUBMED; 9235916.
RA   Chantry D., Vojtek A., Kashishian A., Holtzman D.A., Wood C., Gray P.W.,
RA   Cooper J.A., Hoekstra M.F.;
RT   "p110delta, a novel phosphatidylinositol 3-kinase catalytic subunit that
RT   associates with p85 and is expressed predominantly in leukocytes";
RL   J Biol Chem 272(31):19236-19241(1997).
XX
RN   [2]
RP   1-3132
RA   Vojtek A.B., Cooper J.;
RT   ;
RL   Submitted (22-JAN-1997) to the INSDC.
RL   Biological Chemistry, University of Michigan, 3323 MSRB III, Box 0636, Ann
RL   Arbor, MI 48109-0636, USA
XX
DR   MD5; 7a6c3cc5a4630141afa3e54e2c7f283b.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029057; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029125; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028846; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029574; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028259; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028948; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029606; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027979; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028339; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000105689; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069360; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069424; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069331; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0069001; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069836; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069481; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068947; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0069085; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0069160; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0069005; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0070022; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068963; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068167; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3132
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             1..3132
FT                   /codon_start=1
FT                   /product="phosphatidylinositol 3-kinase catalytic subunit
FT                   p110 delta"
FT                   /db_xref="GOA:O35904"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="PDB:2WXF"
FT                   /db_xref="PDB:2WXG"
FT                   /db_xref="PDB:2WXH"
FT                   /db_xref="PDB:2WXI"
FT                   /db_xref="PDB:2WXJ"
FT                   /db_xref="PDB:2WXK"
FT                   /db_xref="PDB:2WXL"
FT                   /db_xref="PDB:2WXM"
FT                   /db_xref="PDB:2WXN"
FT                   /db_xref="PDB:2WXO"
FT                   /db_xref="PDB:2WXP"
FT                   /db_xref="PDB:2WXQ"
FT                   /db_xref="PDB:2WXR"
FT                   /db_xref="PDB:2X38"
FT                   /db_xref="PDB:4AJW"
FT                   /db_xref="PDB:4V0I"
FT                   /db_xref="PDB:4XE0"
FT                   /db_xref="PDB:5AE8"
FT                   /db_xref="PDB:5AE9"
FT                   /db_xref="PDB:5I4U"
FT                   /db_xref="PDB:5I6U"
FT                   /db_xref="PDB:5IS5"
FT                   /db_xref="PDB:5L72"
FT                   /db_xref="PDB:5NCY"
FT                   /db_xref="PDB:5NCZ"
FT                   /db_xref="PDB:5T27"
FT                   /db_xref="PDB:5T28"
FT                   /db_xref="PDB:5T2B"
FT                   /db_xref="PDB:5T2D"
FT                   /db_xref="PDB:5T2G"
FT                   /db_xref="PDB:5T2I"
FT                   /db_xref="PDB:5T2L"
FT                   /db_xref="PDB:5T2M"
FT                   /db_xref="PDB:5T7F"
FT                   /db_xref="PDB:5T8I"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35904"
FT                   /protein_id="AAC25676.1"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIAKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEELQLREILERR
FT                   GSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVL
FT                   SALELLDSSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGR
FT                   ALANRKIGHFLFWHLHSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKAL
FT                   NDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDS
FT                   KMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPY
FT                   GCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAI
FT                   EEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVP
FT                   FILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELS
FT                   CSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
XX
SQ   Sequence 3132 BP; 690 A; 920 C; 901 G; 621 T; 0 other;
     atgccccctg gggtggactg ccccatggag ttctggacca aagaggagag ccagagcgtg        60
     gttgttgact tcttgctgcc cacaggggtc tacttgaact tccccgtgtc ccgcaatgcc       120
     aacctcagca ccatcaagca ggtgctgtgg caccgtgcac agtatgagcc actcttccac       180
     atgctcagtg accccgaggc ctatgtgttc acctgtgtga accagacggc ggagcagcag       240
     gagttggagg atgagcagcg gaggctgtgc gacatccagc ccttcctgcc cgtgctgcgc       300
     ctcgtggccc gagaggggga ccgcgtgaag aagctcatta actcccagat cagcctcctc       360
     attgccaaag gtctccatga gtttgattcc ctgcgggacc cggaagtaaa cgacttccgc       420
     actaagatgc gccagttttg tgaagaggct gctgctcacc gccagcagct gggctgggtg       480
     gaatggctgc agtacagctt ccccctgcag ctggagccct cagcaagggg ttggcgggcc       540
     ggcttattgc gtgtcagcaa ccgagccctg ctggtcaacg tgaagttcga gggcagtgag       600
     gagagcttca ccttccaggt atccaccaag gacatgcccc tggcactgat ggcctgtgcc       660
     ctccgaaaaa aggccacagt gttccggcag cctctggtgg agcagcctga ggaatatgcc       720
     ctgcaggtga acgggaggca cgaatacctc tacgggaact acccgctctg ccactttcag       780
     tacatctgca gctgcctaca cagcgggctg acccctcatc tgaccatggt ccactcctcc       840
     tccatccttg ctatgcggga tgagcagagc aatcctgccc cccaagtaca gaaaccacgt       900
     gccaaacctc ccccgatccc tgccaagaag ccctcctctg tgtccctgtg gtccctggaa       960
     cagccattct ccattgagct gatcgagggc cgaaaagtga atgctgacga gcggatgaag      1020
     ctggttgttc aggccgggct cttccatgga aatgagatgc tgtgcaagac tgtgtcaagc      1080
     tcggaggtga atgtatgctc agagcccgtg tggaagcagc gactggagtt cgatatcagc      1140
     gtctgtgacc tcccgcgcat ggctcgactc tgttttgctc tctatgccgt cgtggagaag      1200
     gctaagaagg cacgctccac aaagaagaag tctaagaagg cggactgccc catcgcttgg      1260
     gccaacctca tgctattcga ctacaaagat cagctcaaga cgggggagcg ctgcctctac      1320
     atgtggccct ctgtcccaga tgagaaggga gagctgctga atcctgcggg tacagtgcgc      1380
     gggaacccca acacggagag tgccgctgcc ctggtcatct acctgcctga ggtggccccc      1440
     caccctgtgt acttccccgc tctggagaag atcctggagc tggggcgtca cggggagcgt      1500
     gggcgcatca cggaggagga gctgcagctg cgggagatcc tggaacggcg gggatccggg      1560
     gaactgtacg aacatgagaa ggacctggtg tggaagatgc gccacgaagt ccaggagcat      1620
     ttcccagagg cgctggcccg cctgctgctg gtcaccaagt ggaataaaca cgaggatgtg      1680
     gcccagatgc tctatttgct gtgctcctgg cccgagctgc ctgtgctgag cgccctggaa      1740
     cttctggact ctagctttcc cgactgctac gtgggctcct tcgccatcaa gtcccttcgg      1800
     aagctgacgg acgatgagct cttccagtac cttctgcagc tggtgcaagt gctcaaatat      1860
     gagtcctacc tggactgcga gctgaccaaa ttcttgctgg gccgagccct ggctaaccgc      1920
     aagatcggac acttcctgtt ctggcacctc cactctgaga tgcacgtacc atcagtggct      1980
     ctgcggtttg gtctcatcat ggaagcctac tgcagaggca gcacccacca catgaaggtg      2040
     ctgatgaagc agggggaagc actgagcaag cttaaggcac tgaatgactt tgtgaaggtg      2100
     agttcccaga agaccaccaa gccccaaacc aaggagatga tgcatatgtg catgcgccag      2160
     gagacctaca tggaggccct gtcccacctg cagtctccac tcgaccccag caccctgctg      2220
     gaggaagtct gtgtggagca gtgcaccttc atggactcca aaatgaagcc cctgtggatc      2280
     atgtacagca gcgaggaggc gggcagtgct ggcaacgtgg gcatcatctt taagaacggg      2340
     gatgacctcc gccaggacat gctgactctg cagatgatcc agctcatgga cgtcctgtgg      2400
     aagcaggagg gcctggacct gaggatgacg ccctacggct gcctccccac cggggaccgc      2460
     acaggtctca tcgaggtggt cctccactcg gacaccatcg ccaacatcca gctgaacaaa      2520
     agcaacatgg cggccacagc tgccttcaac aaggacgccc tgctcaactg gctcaagtcc      2580
     aagaaccctg gggaggccct ggatcgggcc attgaggaat tcaccctctc ctgtgctggc      2640
     tactgtgtgg ccacatatgt tctgggcatc ggtgaccggc acagcgacaa catcatgatc      2700
     agagagagtg ggcagctctt ccacattgat tttggccact ttctggggaa cttcaagacc      2760
     aagtttggaa tcaaccgaga gcgcgtcccc ttcattctca cctacgactt tgtccacgtg      2820
     atccagcagg ggaagactaa caacagtgag aagtttgaaa ggttccgcgg ctactgtgaa      2880
     cgagcctata ccatcctgcg gcgccacggg ctgcttttcc tccatctctt cgccctgatg      2940
     cgggccgcag gtctgcctga gcttagctgc tccaaagata tccagtatct caaggactct      3000
     ctggcactgg ggaagacgga ggaagaggcg ctaaagcact tccgggtgaa gttcaacgaa      3060
     gctctccgag aaagctggaa aaccaaagtc aactggctgg cgcacaatgt gtccaaggat      3120
     aaccgacagt ag                                                          3132
//