spacer

EBI Dbfetch

ID   U85712; SV 1; linear; mRNA; STD; MUS; 3797 BP.
XX
AC   U85712;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus phospholipase C-beta-1a mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3797
RA   Wu K., Bai J., Marks D.L., Pagano R.E.;
RT   ;
RL   Submitted (16-JAN-1997) to the INSDC.
RL   Biochemistry and Molecular Biology, Mayo Clinic and Foundation, 200 First
RL   Street, S.W., Rochester, MN 55905-0001, USA
XX
DR   MD5; 2b155e18a86a732f4a36c5d4e0851c77.
DR   Ensembl-Gn; ENSMUSG00000051177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070724; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3797
FT                   /organism="Mus musculus"
FT                   /strain="Swiss 3T3"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             4..3654
FT                   /codon_start=1
FT                   /product="phospholipase C-beta-1a"
FT                   /db_xref="GOA:Q9Z1B3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR009535"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR014815"
FT                   /db_xref="InterPro:IPR015359"
FT                   /db_xref="InterPro:IPR016280"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR028400"
FT                   /db_xref="MGI:MGI:97613"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1B3"
FT                   /protein_id="AAD00571.1"
FT                   /translation="MAGAQPGVHALQLKPVCVSDSLKKGTKLVKWDDDSTIVTPTILRT
FT                   DPQGFFFYWTDQNKETELLDLSLVKDARCGKHAEAPKDPKLRELLDVGNIGHLEQRMIT
FT                   VVYGPDLANISHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQV
FT                   TPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPR
FT                   PEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPN
FT                   SSLAKKGQMSVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQL
FT                   AGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECA
FT                   FKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDL
FT                   MYKILVKNKKKSHKSSEGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDD
FT                   DDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGL
FT                   EQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMMALNFQTVDLAMQI
FT                   NMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVG
FT                   TYVEVDMFGLPVDTRRKAFTTKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEG
FT                   GKFIGHRILPVQAIRPGYHYICLRNERNQPLTLPAVFVYIEDKDYVPDTYADVIEALSN
FT                   PIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETSSEAPSETRTTPAENGVNHTASLA
FT                   PKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKLHKKHYKEM
FT                   KDLVKRHHKKTTELIKEHTTKYNEIQIDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSA
FT                   IEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEE
FT                   CQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEATSKDKSQMEEEKTEMIRSYIQEVV
FT                   QYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKPKLQTELEQEYQDKFKRLPLEILEFVQ
FT                   EAMKGKISEDSNHGSAPPSLASDAAKVNLKSPSSEEIERENPGREFDTPL"
XX
SQ   Sequence 3797 BP; 1173 A; 879 C; 950 G; 795 T; 0 other;
     cagatggctg gggctcagcc cggagtgcac gccttgcaac tcaagcccgt gtgcgtgtcc        60
     gacagcctca agaagggcac caaactcgtc aagtgggatg atgactccac tattgttact       120
     ccaactattt tgaggactga tcctcaggga tttttctttt actggacaga ccagaataag       180
     gagacggagc tgttagatct cagccttgtc aaggatgcca ggtgtgggaa gcacgccgaa       240
     gctcccaagg accccaagtt gcgtgaactt ctggatgttg ggaacatcgg acacttggaa       300
     cagcgcatga taactgtggt gtatggacca gacctggcga acatttccca cttgaatctt       360
     gtggcttttc aagaggaagt agccaaggaa tggacaaatg aggttttcag cttggcaaca       420
     aacctgctgg ctcagaacat gtccagggac gcatttctgg agaaagcata tactaagctc       480
     aagctccagg tcaccccaga agggcgcatt cctcttaaaa acatctatcg attgttctca       540
     gcagaccgga agcgcgttga aactgcacta gaggcttgta gtcttccatc ttcgaggaat       600
     gactccattc cccaagagga cttcactcca gatgtataca gagttttcct gaacaatctc       660
     tgtccccgac ctgaaattga taacatcttt tctgaatttg gtgccaaaag caaaccgtac       720
     ctgacggttg atcagatgat ggattttatc aaccttaagc agagagatcc ccggctcaat       780
     gaaatccttt acccacctct gaagcaggag caggtccaag tgttgattga gaaatatgag       840
     cccaacagca gcctcgccaa gaaagggcag atgtcagtgg atggattcat gcgctacctg       900
     agcggagaag aaaatggagt cgtttcacct gagaaactgg atttgaacga agacatgtct       960
     cagcccctgt ctcactattt catcaattcc tcgcacaaca cctacctcac agctggccag      1020
     ttggctggga actcgtctgt agagatgtat cgccaggtgc ttctgtctgg atgtcgctgt      1080
     gtggagctgg actgctggaa gggaaggacc gctgaggaag agcctgtcat tacccatgga      1140
     ttcaccatga caacagaaat atccttcaag gaagtcatag aagccatcgc agagtgtgcg      1200
     ttcaagacgt ctcctttccc catcctcctt tcctttgaga accacgtgga ttccccgaag      1260
     caacaagcca agatggccga gtattgccga ttaatctttg gtgatgccct cctgatggaa      1320
     ccactggaaa aatacccact ggaatctggg gtacctcttc caagccctat ggatttaatg      1380
     tataaaatct tggtgaaaaa caagaagaag tcgcacaagt cgtcagaggg aagtggtaag      1440
     aagaagcttt cagagcaagc ttccaacacc tacagcgact cctccagtgt gttcgagcct      1500
     tcgtctccag gagctgggga agcagatacg gagagtgatg acgatgacga cgacgatgac      1560
     tgtaaaaagt cttccatgga tgaggggaca gctggcagcg aagccatggc cacagaagag      1620
     atgtctaacc tggtgaacta tattcagcct gtcaagtttg agtcctttga aatttcaaaa      1680
     aaaagaaata aaagctttga aatgtcttcc ttcgtggaaa ccaaaggact tgaacaactt      1740
     acaaagtctc cggtggaatt tgtagaatac aacaagatgc aacttagcag gatatatccc      1800
     aagggaacac gtgtggattc atccaactac atgcctcaac tcttctggaa tgctggctgt      1860
     cagatgatgg cgctcaactt ccagacagtg gatctagcta tgcagataaa catgggcatg      1920
     tatgagtaca atgggaagag cggctatagg ctgaagccag agttcatgag gaggccggac      1980
     aagcattttg atccatttac tgaaggaatc gtagatggga tagtggccaa cactctatct      2040
     gttaagatta tttcaggtca gttcctctct gataagaaag ttgggactta tgtggaagtg      2100
     gatatgtttg gcttgcctgt ggacacaagg aggaaggcat ttacaaccaa gacatcccaa      2160
     ggaaatgctg taaaccctgt ctgggaagaa gaacctattg tattcaaaaa ggtagttcta      2220
     ccttctctgg cctgtttgag gatagcagca tatgaagagg gaggcaaatt tattggccac      2280
     cggatattgc ctgtgcaggc tattcggcca ggctatcact acatctgcct gcggaatgag      2340
     aggaaccagc ccctgacgct gccagctgtc tttgtctaca tagaagacaa agattatgtc      2400
     ccagacacgt atgcagatgt aatcgaagca ctatcaaacc caatccgata tgtcaatctg      2460
     atggaacaga gagctaagca gctggctgcg ttgaccctgg aggatgaaga ggaagtaaag      2520
     aaggaggctg accctggaga aacatcttcc gaggctccaa gcgaaaccag gacaacgcca      2580
     gcagagaatg gggtgaatca caccgcatcc cttgcaccca agccgccttc ccaggctcca      2640
     cacagccagc ctgctccagg gtctgtgaag gcacctgcca aaacagaaga tctgatccag      2700
     agcgtgttaa cagaagtaga ggcgcaaacc atcgaagagc tcaagcaaca gaaatcgttc      2760
     gtgaaacttc ataagaaaca ctacaaagaa atgaaagacc tggtgaagag acaccacaag      2820
     aaaaccacgg agctcatcaa ggagcacacg accaagtaca acgagattca gattgactac      2880
     ttgagaagga gggcagcctt ggagaagtcc gccaaaaagg acagcaagaa gaaatctgaa      2940
     cccagcagcc ctgaccacgg ctcatcagcc attgagcaag acctcgctgc cctggatgca      3000
     gaaatgactc agaagttgat agacttgaaa gacaagcaac aacagcagct gcttaatctt      3060
     cggcaagagc agtattacag cgagaagtac caaaagcgag aacacattaa actgcttatt      3120
     cagaagttga cagatgttgc agaagagtgt cagaacaatc agttaaagaa gctgaaggaa      3180
     atctgcgaga aagagaagaa ggaattaaag aagaaaatgg ataagaagag gcaagagaag      3240
     ataacagaag ccacgtccaa agacaaaagc cagatggaag aggagaagac agagatgatc      3300
     cgatcgtaca tccaggaggt ggtgcagtac atcaagaggt tagaggaagc acaaagtaaa      3360
     agacaagaaa aactcgtgga gaaacacaat gagatccgcc agcagatcct cgatgagaag      3420
     cccaagctgc agacggagct ggagcaagaa taccaagaca agttcaaaag gctgcccctg      3480
     gagattctgg agtttgtaca ggaagccatg aaagggaaga tcagcgagga cagcaatcac      3540
     ggctctgccc ctccctctct ggcctcagat gctgcaaagg tgaacctcaa gtctccctcc      3600
     agtgaggaga tagaaagaga gaacccagga agagagtttg atactcctct gtgatgcccc      3660
     tgtcaggcct tccagacatg cacagctgct tgagctccat gggacctcta atgacaaata      3720
     tcactgactg ggccatcttc ctgagaaata tcccttagcc tgaaatccac accaaaggga      3780
     gacttccaga aggatcc                                                     3797
//


spacer
spacer