Dbfetch

ID   U85259; SV 1; linear; mRNA; STD; MUS; 2203 BP.
XX
AC   U85259;
XX
DT   03-APR-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus estrogen related receptor alpha (Estrra) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2203
RA   Sladek R., Amin S., Giguere V.;
RT   "Chromosomal mapping of the human and murine orphan nuclear receptor
RT   ERRalpha (ESTRRA) and identification of a novel human ERRalpha-related
RT   pseudogene";
RL   Unpublished.
XX
RN   [2]
RP   1-2203
RA   Sladek R., Amin S., Giguere V.;
RT   ;
RL   Submitted (13-JAN-1997) to the INSDC.
RL   Molecular Oncology Group, Royal Victoria Hospital, 687 Pine Avenue West,
RL   Montreal, QC H3A 1A1, Canada
XX
DR   MD5; 1d56d92fd3684b80327921fbcb31150b.
DR   Ensembl-Gn; ENSMUSG00000024955; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024770; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024736; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024709; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024736; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024504; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023976; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_DBA2J_G0024603; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024569; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024689; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024598; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025230; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023722; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024038; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025906; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050857; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050837; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050793; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050786; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050663; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_DBA2J_T0050561; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050527; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050685; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050523; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051394; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049817; mus_musculus_wsbeij.
DR   EuropePMC; PMC232390; 9271417.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2203
FT                   /organism="Mus musculus"
FT                   /chromosome="19"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /clone_lib="10.5 dpc embryonic library"
FT                   /db_xref="taxon:10090"
FT   CDS             167..1429
FT                   /codon_start=1
FT                   /gene="Estrra"
FT                   /product="estrogen related receptor alpha"
FT                   /note="transcription factor formerly known as ERR1; nuclear
FT                   hormone receptor"
FT                   /db_xref="GOA:O08580"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR024178"
FT                   /db_xref="InterPro:IPR027289"
FT                   /db_xref="InterPro:IPR035500"
FT                   /db_xref="MGI:MGI:1346831"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08580"
FT                   /protein_id="AAB51250.1"
FT                   /translation="MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVTLASGPAPAR
FT                   CLPGHKEEEDGEGAGSGEQGSGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFK
FT                   RTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKR
FT                   RPEVDPLPFPGPFPAGPLAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPASPDGHLP
FT                   AVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQGSLPLQD
FT                   ELAFAEDLVLDEEGARAAGLGDLGAALQLVRRLQALRLEREEYVLLKALALANSDSVHI
FT                   EDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYG
FT                   VKLEGKVHAQVFLEMLEAMMD"
XX
SQ   Sequence 2203 BP; 426 A; 626 C; 731 G; 420 T; 0 other;
     gcggctgctt cctacaagca gccagcggcg ccgccgagtg aggggggacg cagcgcggcg        60
     gggcggtgcg gccggaggag gcggcccccg ctcaccccgg cgctccgggc cactcggccc       120
     ccatgcctgc ccgccagccc tgccggagcc caaggtgacc agcaccatgt ccagccaggt       180
     ggtgggcatc gagcctctct acatcaaggc agagccagcc agccctgaca gtccaaaggg       240
     ttcctcagag actgagactg aacccccggt gaccctggcc tctggtccag ctccagcccg       300
     ctgccttcca gggcacaagg aggaggagga tggggagggg gcagggtctg gtgagcaggg       360
     cagtgggaag ctagtgctca gctctctacc caaacgcctc tgcctggtct gtggggatgt       420
     ggcctctggc taccactacg gtgtggcatc ctgtgaggcc tgcaaagcct tcttcaagag       480
     gaccatccag gggagcatcg agtacagctg tccggcctcc aatgagtgtg agatcaccaa       540
     gcggagacgc aaggcctgtc aggcctgccg cttcaccaag tgcctgcggg tgggcatgct       600
     caaggaggga gtgcgtctgg accgtgtccg cggaggacgg cagaagtaca aacggcggcc       660
     agaggtggac cctttgcctt tcccgggccc cttccctgct ggacctctgg ctgtagctgg       720
     aggacccagg aagacagccc cagtgaacgc tctggtgtcg catctgctgg ttgttgaacc       780
     tgagaagctg tacgccatgc ctgacccagc aagccccgat ggacacctcc ccgctgtggc       840
     cactctctgt gacctttttg atcgagagat agtggtcacc atcagctggg ccaagagcat       900
     cccaggcttc tcctcactgt cactgtctga ccagatgtca gtactgcaga gtgtgtggat       960
     ggaagtgctg gtgctgggtg tggcccaagg ctcactgcca ctgcaggatg agctggcctt      1020
     tgctgaggac ctggtcctag atgaagaggg ggcacgggca gctggcctgg gggatctggg      1080
     ggcagccctg cagctggttc ggcgactgca agctcttcgg ctggagcggg aggagtacgt      1140
     cctgctgaaa gctctggccc ttgccaattc tgactctgtg cacattgaag atgctgaggc      1200
     tgtggagcag ctgcgcgaag ccctgcatga ggccctgctg gagtatgaag ctggccgggc      1260
     tggccctgga gggggtgctg agcggaggcg tgcaggcagg ctgctgctta cgctgccact      1320
     cctccgccag acagcaggca aagtcctggc ccatttctat ggggtgaagc tggagggcaa      1380
     ggtgcatgca caagtgtttt tggaaatgct tgaggccatg atggactgag gcaaggggtg      1440
     ggacagggtg gggtggctgg caggatctgc ccagcatagg gtgttagccc aaagcggaaa      1500
     gctggagtct gggcagtgcc atagcctgct ggcagggcca gggcaatgcc atccgcccct      1560
     gggagaacgt tcatgccctt ccctccccac tttgtgtgtg tgggggattg tcagaagcca      1620
     ggaaagtgaa tgcccaggtg tgggcacagt gctgcccctt gcagccataa cgagcccccc      1680
     aagagtgttg gggggctcgc ggaagccata gggggctgca ggggatgtgc aggaggcaga      1740
     cattgatctc agggagggaa gggatggagg ccgccggctc ccactgggtg atgcttttgc      1800
     tgctgcttaa tccgatctcc tctccggagc agaggggggc ttggaaagca aaggccccgt      1860
     cccttcgctc ctctcctcat ccgcattggg cattattgcc cccccttgaa gcaataactc      1920
     caagcaggct ccagcccctg gacccccggg gtggccaggg ccccctatca gctcccacct      1980
     caaggggtgg gggacagcac tgcctctatg ccctgcagag caataacact atatttattt      2040
     ttgggtttgg ccagggaggc gcagggccat ggggcaagcc agggcccaga gcccttggct      2100
     gtacagagac tctattttaa tgtatatttg ctgcaaagag aaaccgcttt tggttttgaa      2160
     cctttaatga gaaaaaaata tactatggag ctcaagtaaa aaa                        2203
//