Dbfetch

ID   U85055; SV 1; linear; mRNA; STD; MUS; 2208 BP.
XX
AC   U85055;
XX
DT   08-FEB-1997 (Rel. 50, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus rap1/rap2 interacting protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2208
RA   Janoueix-Lerosey I., Tavitian A., De Gunzburg J.;
RT   ;
RL   Submitted (13-JAN-1997) to the INSDC.
RL   Unit INSERM 248, Institut Curie, 26 rue d'Ulm, Paris 75231, France
XX
DR   MD5; ea381fca023f0a1e1a52804371427e42.
DR   Ensembl-Gn; ENSMUSG00000052087; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020593; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0020547; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0020525; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020543; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020977; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019856; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0020302; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_FVBNJ_G0020404; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0020501; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020433; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021020; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019918; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000063771; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0037180; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0037116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0037085; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0037134; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0037588; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0036832; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0036797; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_FVBNJ_T0036904; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0037068; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0036901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0037643; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0036299; mus_musculus_wsbeij.
DR   EuropePMC; PMC2064444; 17635935.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2208
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1644
FT                   /codon_start=1
FT                   /product="rap1/rap2 interacting protein"
FT                   /db_xref="GOA:P97492"
FT                   /db_xref="InterPro:IPR003109"
FT                   /db_xref="InterPro:IPR003116"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR030776"
FT                   /db_xref="MGI:MGI:1859709"
FT                   /db_xref="PDB:1WFY"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97492"
FT                   /protein_id="AAB41893.1"
FT                   /translation="MPGKPKHLGVPNGRMVLAVSDGELTSTAGSQAQGEGRGSSLSIHS
FT                   LPSGPSSPFSTEEQPVASWAQSFERLLQDPRGLAYFTEFLKKEFSAENVTFWKACERFQ
FT                   QIPASDTKQLAQEAHNIYHEFLSSQALSPVNIDRQAWLSEEVLAQPRPDMFRAQQLQIF
FT                   NLMKFDSYARFVKSPLYQECLLAEAEGRPLREPGSSHLGSPDTARKKPKLKPGKSLPLG
FT                   VEELGQLPLAEGPCGRPLRKSFRREMTGGAMNSALRRESQGSLNSSASLDLGFLAFVSS
FT                   KSESHRKSLGSGESESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSL
FT                   PDIKVYLVGNEQKALVLDQDCTVLADQEVRLENRITFQLELVGLERVVRISAKPTKRLQ
FT                   EALQPILAKHGLSLDQVVLHRPGEKQPMDLETPVSSVASQTLVLDTPPDAKMSEARSIS
FT                   PCRSQGCLPRTQTKDSHLPPSSSSLLVEDASSSTGNRQTCDIEGLVELLNRVQSSGAHD
FT                   QRGLLRKEDLVLPEFLQLPSQRPGSREAPP"
XX
SQ   Sequence 2208 BP; 494 A; 626 C; 636 G; 450 T; 2 other;
     atgccaggga agcccaagca cttgggtgtc cccaacgggc gcatggttct ggctgtctca        60
     gatggagaac tgaccagcac tgcaggttcc caggcccagg gtgagggcag aggcagctct       120
     ctcagcatcc acagcctccc tagtggcccc agcagcccct tctccaccga ggagcagcct       180
     gtggccagct gggcccagtc ctttgagcgg ctgctgcaag acccacgggg tctggcttac       240
     ttcactgagt tcctgaagaa ggaattcagc gcagagaacg taactttctg gaaagcctgc       300
     gaacgtttcc agcagatccc agccagcgac accaagcagc tagctcagga ggcccacaac       360
     atctaccacg agttcctatc cagccaggcg ctgagcccag tgaacatcga ccgacaggcc       420
     tggcttagtg aggaggtgct ggcccagccc cggccagata tgttccgagc acagcagctt       480
     cagatcttca atttgatgaa gttcgacagc tatgcgcgct tcgtcaaatc cccgctgtac       540
     caagagtgcc tgctggcgga ggccgaggga cgccccctgc gggaacctgg ctcctcacac       600
     ctcgggagcc cggacacagc gaggaagaag ccaaagctga agcctgggaa gtcactgccg       660
     ctgggcgtgg aagagttggg gcagctgcca ctcgctgagg gcccttgtgg ccgccctctc       720
     cgcaagtcct ttcgtagaga gatgacaggt ggagccatga attcggccct gcgacgagag       780
     tctcaagggt ccctgaattc ttctgccagt ctggacctgg gtttccttgc ctttgtgagc       840
     agcaaatctg agagtcaccg gaagagcctt ggaagtggag agagtgagag cgagagtcgg       900
     ccggggaagt attgctgcgt gtatctacct gacggcacgg cttccttggc cctggctcga       960
     cctggcctca ccatccgaga catgctggca ggcatctgtg agaagagagg cctctctctg      1020
     cctgacatta aggtctacct ggtgggcaat gaacagaagg ccctggtcct ggatcaggat      1080
     tgcaccgtgc tggcagacca ggaagtgcga ctggaaaaca ggatcacctt ccagctggag      1140
     ttggtcggcc tggagcgagt ggtccggatc tcagctaagc ccaccaagcg tctgcaagag      1200
     gcgctgcagc ccatcctggc taagcatggc ctgagcctgg accaggtggt actgcacagg      1260
     ccaggagaga agcagcccat ggatttggag actccagtga gctcagtggc ctcacagaca      1320
     ctggttttgg acactcctcc ggatgcaaag atgagtgaag ccagaagcat atccccctgc      1380
     cgcagtcagg gatgcctccc aagaacccag accaaggaca gtcaccttcc cccatcgtcc      1440
     tccagtttgc tggtagaaga tgccagtagt tctactggga accggcagac ctgtgacatt      1500
     gaaggcctgg tggagctgct gaatcgggtg cagagcagcg gggcccacga tcagagagga      1560
     cttcttcgca aagaggacct ggtccttcca gaatttctgc agcttccttc ccaaagacca      1620
     ggctctcggg aggctccacc atagactgaa tcaactattc agcccaggga ggcccttcag      1680
     actccaccac ccacccggtc ctctggcatc tgtgtaacaa tccaggctat ctgcatggtg      1740
     cctgggcaaa ccaagcatgc cacgggtctg tgctgcatgc cctatctgta ccatgagtgt      1800
     ctttggctcc tttctgctat gggcaggcnn ccagaaaggg ccaggagggg ggggctaact      1860
     gttctctcat aggtttgcct acccattcct cccagtaggc catcaagagg aggtgggcct      1920
     agttccttgg cataagcata gtgaacacaa atgggtgact ttggcagtgc cagcctcctc      1980
     aacttgttct aggctttagc agggggcagg aaggaggggc tggcccctcc ttaaagagtt      2040
     gatataagta agacctgggt gtactggtga gcaacccctc cctccatcca cagactctac      2100
     tgtacatatg gattttatgg ttggcttggg gcagctgggt ttgtcctgga tatatggtac      2160
     tgttatataa taataataat tatcattatt aaaaaaaaag ctcgacca                   2208
//