spacer

EBI Dbfetch

ID   U85020; SV 1; linear; mRNA; STD; MUS; 4411 BP.
XX
AC   U85020;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus M-CSF-induced cysteine protease mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4411
RA   Algate P.A.;
RT   ;
RL   Submitted (10-JAN-1997) to the INSDC.
RL   Basic Sciences, Fred Hutchinson Cancer Research Center, 1124 Columbia
RL   Street, Seattle, WA 98104, USA
XX
DR   MD5; d1fbdcd7c8530080f2ea058362a94767.
DR   Ensembl-Gn; ENSMUSG00000035547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107112; mus_musculus.
DR   RFAM; RF00005; tRNA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4411
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="MAC-11"
FT                   /cell_line="myeloid cell line FDC-P1"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..180
FT   CDS             181..2103
FT                   /codon_start=1
FT                   /product="M-CSF-induced cysteine protease"
FT                   /note="calpain-like cysteine protease"
FT                   /db_xref="GOA:O08688"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022682"
FT                   /db_xref="InterPro:IPR022683"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="MGI:MGI:1100859"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08688"
FT                   /protein_id="AAD00559.1"
FT                   /translation="MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTP
FT                   GPTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDW
FT                   KEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALV
FT                   EKAYAKLAGCYQALDGGNTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVH
FT                   SRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIR
FT                   LRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKC
FT                   RLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPED
FT                   EVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVF
FT                   LRTELPEGRYVIIPTTFEPGHTGEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQ
FT                   VAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQP
FT                   ITVQVWNHRVLKDEFLGQVHLKTAPDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCSA
FT                   SLTAV"
FT   misc_feature    181..330
FT                   /note="encodes putative domain I"
FT   misc_feature    331..1158
FT                   /note="encodes putative domain II"
FT   misc_feature    1159..1692
FT                   /note="encodes putative domain III"
FT   misc_feature    1693..2100
FT                   /note="encodes putative domain IV"
FT   3'UTR           2104..4410
FT   polyA_signal    4390..4395
FT   polyA_site      4411
FT                   /note="24 A nucleotides"
XX
SQ   Sequence 4411 BP; 950 A; 1279 C; 1181 G; 1001 T; 0 other;
     tccaagttcc aacccctgcc tgcgggctgc cggggcatca tctccccgca gagtcccagg        60
     ctgtggcgcg ggctggtcta gcctccgctc cagtgcccgc actgtgctct gcatcccggg       120
     agtccagctc cagctgcggc gacgcggcag gtgcctcccc ttcttgggga cgtggtcacc       180
     atgttctcct gcgcgaaggc ctatgaggac cagaactact cggcgctgaa gcgggcctgc       240
     ctgcgcaaga aggtgctgtt cgaggatccc ctcttccctg ccaccgacga ctccctttac       300
     tataagggca ccccagggcc cacagtcagg tggaagcggc ctaaggatat ctgcgacgat       360
     ccccggctct tcgtagatgg catcagctcc catgacctgc accagggcca ggtgggcaac       420
     tgctggtttg tggctgcctg ctcatcactg gcctcccgag agtcactctg gcagaaggtc       480
     atcccagact ggaaggagca ggaatggaac cccgagaagc ctgacagcta tgctggcatc       540
     ttccacttca acttctggcg ctttggggag tgggtggacg taatcgtcga tgaccggctg       600
     cccacagtca acaaccagct catttactgc cattccaact ccaaaaatga gttctggtgt       660
     gccctggtgg agaaggccta tgccaagctg gccggctgtt accaggccct ggacggaggc       720
     aacacggccg atgcattggt ggatttcaca ggtggtgttt ctgaacccat tgacctgacc       780
     gagggggact tggccactga cgaggctaag aggaatcagc tctttgagcg agtgctgaag       840
     gtgcacagca gaggcgggct catcagtgcc tccatcaagg ctgtgacagc agctgacatg       900
     gaggcccgcc tggcatgtgg cctggtgaag ggccatgcat acgctgtcac cgatgtgcgc       960
     aaggtgcgcc tgggccatgg cctgctggcc ttcttcaagt cagagaagct tgatatgatc      1020
     cgtctgagga acccctgggg cgagcgggag tggacggggc cctggagtga cacgtcagag      1080
     gaatggcaga aagtgagcaa gagtgagagg gagaagatgg gcgtgaccgt gcaggatgat      1140
     ggggaattct ggatgacctt tgaggacatg tgccggtact ttactgacat cattaaatgc      1200
     cgcctgatta acacgtccta cctgagcatc cataagacat gggaggaggc ccggctgcat      1260
     ggtgcctgga cgagacatga ggacccacag cagaaccgca gtggaggctg catcaaccac      1320
     aaggacactt tcttccagaa cccacagtac gtatttgaag tcaagaagcc agaagatgaa      1380
     gtgttgatca gtatccagca gcggccgaag cgctcaactc gccgggaggg caaaggcgag      1440
     aatctggcca ttggcttcga catctataag gtggaagaga accgccaata ccgtatgcac      1500
     agcctacagc ataaggccgc cagctccatc tacatcaatt cccgcagcgt ttttttgagg      1560
     acagagctgc ccgagggccg ctacgttatc atccctacca cctttgagcc aggccacact      1620
     ggcgagttcc tgctccgagt cttcacagat gtcccctcca actgccggga actacgcctg      1680
     gatgagcccc ctaggacctg ttggagttcc ctctgtggct accctcagca ggtggcccag      1740
     gtccatgtct tgggggctgc tggcctcaag gactccccaa caggagcaaa ctcatatgtg      1800
     atcatcaagt gtgagggcga aaaggttcgc tcagctgtgc agagagggac ctcgacacca      1860
     gagtacaatg taaaaggcat cttctatcgc aagaagctgg ctcagcctat caccgtgcag      1920
     gtttggaatc accgagtcct gaaggatgaa tttctgggcc aggtgcacct gaagactgcc      1980
     ccggatgacc tgcaggacct ccacaccctc catctccagg accgcagtag ccggcagccc      2040
     agtgacctgc caggcattgt agctgtgcga gtcctctgca gtgcctctct cacggctgtc      2100
     tgaccccagc ctgcctgtcc tgccccacta gtcctcacca ctactcgcat gtccccacct      2160
     tgcctgggac cagcctggga accagacacc ggggcccttt cctcactctt ccactgaccc      2220
     actgtgtgac ctgaagagag ccctgccctc tctgagcctc agtgtttgga ggtccccaaa      2280
     gaattcccgt cttgtggggg agttttcttg cctaagattt aatgcagttc tctctaccca      2340
     gtgggcgctg ctgttaaggg gccatctgct gaatacgttt ccccaggccc tgctgtctgc      2400
     caggagtgcc aagtgtcaac tgtttacaca caaactgcca tgtcccacgc cccttccctc      2460
     tccttgtttg ctatggggga gattgcttcc cgccccagat ctttgctatg tagcttagag      2520
     tgaccttaaa cttatgatcc ccctgcctcc acctcctcaa tgccatacca ctataccagt      2580
     ttgagtggtg ctgggtatgg aacccagggc tttgtgcatg ctaggcgagc acttaccaac      2640
     tgagctacat ccccaatccc actacagccc attttaaaac catcttgaaa gaacccttat      2700
     tggcatatgc agtagacatc tgctcattgt ctaatgcctg acccccattc atttagttat      2760
     tcaatataga cttgcccaat tagcccatcg agcctcccta ggcttcccga ttctcaggtc      2820
     ttctcggagg cagatccctt cctgagctcc aggctctgac ttcaccgtca ccctctgaag      2880
     agctatgatc atgctggtga gaaagtatga tttcccaacc tctgcttgtg gtgttggaag      2940
     gagtggcctg gccaggcagg ttgatgtaag gctatgggag acccaagggg gacacatgct      3000
     gcctctgctg aaagaccctg ggtttttctt ggaagaaagg actctagggt ggatggtacc      3060
     aggccttcag ggttagatca tctgtcgagt gtcaccgatg gggacttccc atgaccagag      3120
     ggctctgcac cagcatcccc aaagagccaa ggaggccacc atgcttttac tgtccagacc      3180
     aaaatgttgc tctcaatccc caacatttga tagtcttagc atttaaacaa aatctccgcg      3240
     tgagggaggc cagcccccac atttgtcctc tgcaggctca ttttgttgag cgtctgcttt      3300
     tatcttgaca ctgagcacga gagggcacgg gtgggtgctc acagtgggac cttcttggag      3360
     gaatctcaga gggggacaga gatgagatgt gcattcctgg ctgccacctg cattcctgag      3420
     gaactcttgt ttactggtgc tgtggctcac aggtccccct ctgtgccctc cttcagcttc      3480
     caggccagac ttagtagata aatagtaata ataataataa tacaattgag ttatcagcca      3540
     caattccttt tggaactgtt acactctgcc tctggtccct ccaacgtggt cctcttcctg      3600
     gctggaggtg ctggattctg actgccatct tgctccatgg tggctcttct ggcctgggac      3660
     ccggtccaca ggaagggcta ggagctgaat taaagatgag agcatccctc ctgcacactg      3720
     gggcttccct tcaccaggag caaatcactt caacctcccg tgcctcgttt cctccctctg      3780
     tagcgtgggg ctcgagactc ctgttggtga gggactctta caaggataag agcaaggcca      3840
     caccacttcc gctgtgtatc agtctatcat acactccgca cggtcacatg atcacttcac      3900
     ttctcgatgg ctattgcaga ccaagactgc agtcaggaag ggagggtgag cctcaccatc      3960
     ttgggtctca gggcctgaca tgggggtctt agctcagcca tatccctctg aggcacaggg      4020
     cgagcaggga ccaagtagca gacgagtcga tgcttcacct ggcatctagc cactgcctcc      4080
     cacttctagc agaactgggt cagcagccct gttcttgctt cctctctctt aagctaggcc      4140
     aggctggctc ctggctgtga aggaacttcc ggtccccaag aagccttgaa gactggacaa      4200
     gggaggacag ggtggagcag ggatagccgt ggcttcattt atcgtttgca cccaggaggc      4260
     cttgtagtct tccaattgca ggagatcagc cctacagtgt attctatgtg gaccaacagg      4320
     gcctggcctt cactcttcca ggccacaatg ccctggggtc aagggaaagg aactctgtta      4380
     tcttctcaga ataaatatta ctgccgctct a                                     4411
//


spacer
spacer