spacer

EBI Dbfetch

ID   U84012; SV 1; linear; mRNA; STD; MUS; 2520 BP.
XX
AC   U84012;
XX
DT   01-FEB-1997 (Rel. 50, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus hippocampal amyloid precursor protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2520
RA   Flood J.F., Kumar V.B., Sasser T., Word I., Morley J.E.;
RT   "Antisense to mRNA for amyloid precursor protein restores impaired learning
RT   and memory in SAMP8 mice";
RL   Unpublished.
XX
RN   [2]
RP   1-2520
RA   Kumar V.B., Flood J.F., Sasser T., Word I., Morley J.E.;
RT   ;
RL   Submitted (07-JAN-1997) to the INSDC.
RL   Geriatric Research, VA Medical Center, 11G/JB VA Medical Center, St.Louis,
RL   MO 63125, USA
XX
DR   MD5; 53e035dc0066c5f4a8c0273d77b3d664.
DR   Ensembl-Gn; ENSMUSG00000022892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005406; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2520
FT                   /organism="Mus musculus"
FT                   /strain="SAMP8"
FT                   /mol_type="mRNA"
FT                   /tissue_type="hippocampus"
FT                   /note="senescence accelerated mouse P8"
FT                   /db_xref="taxon:10090"
FT   CDS             139..2226
FT                   /codon_start=1
FT                   /product="hippocampal amyloid precursor protein"
FT                   /db_xref="GOA:P12023"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR008154"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR011178"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR015849"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019744"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR020901"
FT                   /db_xref="InterPro:IPR024329"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="PDB:2ROZ"
FT                   /db_xref="PDB:2YSZ"
FT                   /db_xref="PDB:2YT0"
FT                   /db_xref="PDB:2YT1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12023"
FT                   /protein_id="AAB41502.1"
FT                   /translation="MLPSLALLLLAAWTVRALEVPTDGNAGLLAEPQIAMFCGKLNMHM
FT                   NVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQ
FT                   CKTHTHIVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKST
FT                   NLHDYGMLLPCGIDKFRGVEFVCCPLAEESDSVDSADAEEDDSDVWWGGADTDYADGGE
FT                   DKVVEVAEEEEVADVEEEEADDDEDVEDGDEVEEEAEEPYEEATERTTSTATTTTTTTE
FT                   SVEEVVRVPTTAASTPDAADKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEE
FT                   AERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALE
FT                   NYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTH
FT                   LRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDA
FT                   LMPSLTETKTTVELLPVNGEFSLDDLQPWHPFGVDSVPANTENEVEPVDARPAADRGLT
FT                   TRPGSGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGV
FT                   VIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQ
FT                   N"
XX
SQ   Sequence 2520 BP; 676 A; 662 C; 725 G; 457 T; 0 other;
     cggcggcggg aggcgagacg accgggagca gacgaggcgc ggggccaccg gagacggcgg        60
     cggcggcgcg gacacagcca gggcgcggcg gatcttccac tcgcacacgg agcactcggt       120
     ggcccacgca ggatcacgat gctgcccagc ttggcactgc tcctgctggc cgcctggacg       180
     gttcgggctc tggaggtacc cactgatggc aacgccgggc tgctggcaga accccagatc       240
     gccatgttct gtggtaaact caacatgcac atgaatgtgc agaatggaaa gtgggagtca       300
     gacccgtcag ggaccaaaac ctgcattggc accaaggagg gcatcttgca gtactgccaa       360
     gaggtctacc ctgaactgca gatcacaaac gtggtggaag ccaaccagcc agtgaccatc       420
     cagaactggt gcaagcgggg ccgcaagcag tgcaagacac acacccacat cgtgattcct       480
     taccgttgcc tagttggtga gtttgtgagc gacgcccttc tcgtgcccga caagtgcaag       540
     ttcctacacc aggagcggat ggatgtttgt gagacccatc ttcactggca caccgtcgcc       600
     aaagagacat gcagcgagaa gagcactaac ttgcacgact atggcatgct gctgccctgc       660
     ggcatcgaca agttccgagg ggtagagttt gtatgctgcc cgttggccga ggaaagcgac       720
     agcgtggatt ctgcggatgc agaggaggat gactctgatg tctggtgggg tggagcggac       780
     acagactacg ctgatggcgg tgaagacaaa gtagtagaag tcgccgaaga ggaggaagtg       840
     gctgatgttg aggaagagga agctgatgat gatgaggatg tggaggatgg ggacgaggtg       900
     gaggaggagg ccgaggagcc ctacgaagag gccaccgaga gaacaaccag cactgccacc       960
     accaccacaa ccaccactga gtccgtggag gaggtggtcc gagttcccac gacagcagcc      1020
     agcacccccg acgccgccga caagtacctg gagacacccg gggacgagaa cgagcatgcc      1080
     catttccaga aagccaaaga gaggctggaa gccaagcacc gagagagaat gtcccaggtc      1140
     atgagagaat gggaagaggc agagcgtcaa gccaagaact tgcccaaagc tgacaagaag      1200
     gccgttatcc agcatttcca ggagaaagtg gaatctctgg aacaggaagc agccaatgag      1260
     agacagcagc ttgtagagac acacatggcc agagttgaag ccatgctcaa tgaccgccgc      1320
     cgcctggccc tcgagaatta catcactgca ctgcaggcgg tgcccccaag gcctcatcat      1380
     gtgttcaaca tgctgaagaa gtacgtccgt gcggagcaga aagacagaca gcacacccta      1440
     aagcattttg aacatgtgcg catggtggac cccaagaaag ctgctcagat ccggtcccag      1500
     gttatgacac acctccgtgt gatctacgag cgcatgaacc agtctctgtc cctgctctac      1560
     aatgtccctg cggtggctga ggagattcaa gatgaagtcg atgagctgct tcagaaggag      1620
     cagaactact ccgacgatgt cttggccaac atgatcagtg agcccagaat cagctacgga      1680
     aacgacgctc tcatgccttc gctgacggaa accaagacca ccgtggagct ccttcccgtg      1740
     aatggggaat tcagcctgga tgacctccag ccgtggcacc cttttggggt ggactctgtg      1800
     ccagccaata ccgaaaatga agtcgagcct gttgacgccc gccccgctgc tgaccgagga      1860
     ctgaccactc gaccaggttc tgggctgaca aacatcaaga cggaagagat ctcggaagtg      1920
     aagatggatg cagaattcgg acatgattca ggatttgaag tccgccatca aaaactggtg      1980
     ttctttgctg aagatgtggg ttcgaacaaa ggcgccatca tcggactcat ggtgggcggc      2040
     gttgtcatag caaccgtgat tgtcatcacc ctggtgatgt tgaagaagaa acagtacaca      2100
     tccatccatc atggcgtggt ggaggtcgac gccgccgtga ccccagagga gcgccatctc      2160
     tccaagatgc agcagaacgg atatgagaat ccaacttaca agttctttga gcaaatgcag      2220
     aactaagccc cacccgcgcc acagcagcgg cctctgaact tggacagcga aaccattgct      2280
     tcactaccca tcggtgttca tttataaaat aacgtggaaa gaaacaaacc cggaattcca      2340
     tgatgtagcc tgacaagaaa ttttgtcagt gtataaacct aggtagtatt gtgcacttac      2400
     actgaaggag gaattcacaa tggtcaaatc agtgcacaat actacctagg tttatacact      2460
     gacaaaattt cttgtcaggc tacatcatta ttttaaatga catttcacag catggaattc      2520
//


spacer
spacer