spacer

EBI Dbfetch

ID   U82624; SV 1; linear; genomic DNA; STD; MUS; 7097 BP.
XX
AC   U82624;
XX
DT   21-JAN-1997 (Rel. 50, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus amyloid precursor protein (APP) gene, partial cds, exons 16
DE   and 17.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-7097
RA   Wragg M.A., Busfield F., Duff K., Korenblat K., Capecchi M., Loring J.F.,
RA   Goate A.M.;
RT   "Introduction of six mutations into the mouse genome using 'Hit and Run'
RT   gene-targeting: Introduction of familial Alzheimer's disease mutations into
RT   the mouse amyloid precursor protein gene and humanization of the A-beta
RT   fragment";
RL   Unpublished.
XX
RN   [2]
RP   1-7097
RA   Wragg M.A., Duff K., Korenblat K.;
RT   ;
RL   Submitted (18-DEC-1996) to the INSDC.
RL   Psychiatry, Washington University School of Medicine, 4940 Children's
RL   Place, St. Louis, MO 63110, USA
XX
DR   MD5; 90ebdf8f7f8c16ad8554e9bbc2791697.
DR   Ensembl-Gn; ENSMUSG00000022892; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005406; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7097
FT                   /organism="Mus musculus"
FT                   /chromosome="16"
FT                   /strain="129SV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            join(<1999..2099,4895..>5041)
FT                   /gene="APP"
FT                   /product="amyloid precursor protein"
FT   exon            1999..2099
FT                   /gene="APP"
FT                   /number=16
FT   CDS             join(<1999..2099,4895..>5041)
FT                   /codon_start=3
FT                   /gene="APP"
FT                   /product="amyloid precursor protein"
FT                   /note="Alzheimer's disease associated"
FT                   /db_xref="GOA:P12023"
FT                   /db_xref="InterPro:IPR002223"
FT                   /db_xref="InterPro:IPR008154"
FT                   /db_xref="InterPro:IPR008155"
FT                   /db_xref="InterPro:IPR011178"
FT                   /db_xref="InterPro:IPR013803"
FT                   /db_xref="InterPro:IPR015849"
FT                   /db_xref="InterPro:IPR019543"
FT                   /db_xref="InterPro:IPR019744"
FT                   /db_xref="InterPro:IPR019745"
FT                   /db_xref="InterPro:IPR020901"
FT                   /db_xref="InterPro:IPR024329"
FT                   /db_xref="InterPro:IPR028866"
FT                   /db_xref="MGI:MGI:88059"
FT                   /db_xref="PDB:2ROZ"
FT                   /db_xref="PDB:2YSZ"
FT                   /db_xref="PDB:2YT0"
FT                   /db_xref="PDB:2YT1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12023"
FT                   /protein_id="AAB40919.1"
FT                   /translation="SGLTNIKTEEISEVKMDAEFGHDSGFEVRHQKLVFFAEDVGSNKG
FT                   AIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVE"
FT   intron          2100..4894
FT                   /gene="APP"
FT   exon            4895..5041
FT                   /gene="APP"
FT                   /number=17
XX
SQ   Sequence 7097 BP; 2013 A; 1517 C; 1595 G; 1972 T; 0 other;
     aacaagtagc cccagaactt agcagcttca tagagcaagc gtttagctcc ttacagcagt        60
     ttcagccagc cagcatttta gcatagggca gagctggctg gttctggctc aggctctttc       120
     atgaaatcac aatgaagaca ctgccaaagc tgtggtctcc tgaaggtctg gctagagctg       180
     acagagatca agcactctgg taccttccca tggcagctgg cttcccacac accaagaagt       240
     acaatagagg gaataagaaa gaagctttgg tgccttttat aaggcatcag ttctgccatg       300
     ttctacttac atagatacca tatcatcccc tgctccggag aacaaaagaa caaagttctg       360
     gttttgaaat cattattaat aataaatgtg tgttgtatac tcacatatgt agacaagtac       420
     agttccctac aacccaggct aagaacacat gaagaggaac ttgaacaaca gtggctagtc       480
     attgtgagag ttagaacaga agagtaggaa ggcccagcta gaaggaaatg gggaagtgtg       540
     atccagagga cagaagcgag ggagagcagc attgtactgt gagcagattg gcattcatca       600
     tgagcctggt ttacggtggg ttgtccaagg gaagcgttgt gggcagttag acaagaggtg       660
     gtgatgagtc acacccagca tggactgccc aggtctgtca attatactca ctctcagcag       720
     aagccatgct gactggctga cgggctttct cagtgcttat gaccttgtgc ttttcagggt       780
     cagcaggggg ttgacaagtt ttccaatact tgatggacaa gattggaaga gccattagac       840
     ccagaagagg caatgagttc ccacaggagt tgcgggaatt cacaatgtgt agccagagaa       900
     aggaatcctc actgccttgc ctttaatgtc tgacacacgt gctcaaacct acctggtgtc       960
     acagatagat gcctggctca ctcgaatagg accaggcctg cggtgtaggt tacagggaga      1020
     ccgtgttgca gtaatctgta ggaaacaaaa tcattctctc tggtatgcaa actgacctct      1080
     acctttgaat tcacgtaggt gctaagaacc tgcctccatt ggaaacatca tggaggaggt      1140
     ggctctaaaa gcccttcctt catagcctca gattctactt cagtaggatc acttcagaaa      1200
     acacgacaat cgatgcaaac ggacatccct tctgtctgtc ttcacttcca tttctaaaac      1260
     atattttacc ttttagtttt gagcctcaga tgaatagttg aatcatgaaa cgctgtaaga      1320
     attggtccaa gaagccatgc agccacgtat agagaaagag gaattaggta atgaattcta      1380
     ttgatcccag agacgctctc tgttcattgt gtgctccttt cgagtcagcg gatgaagcga      1440
     ttccacgggg cgtgttcagc tagagagctg ggatgctgag ctaaacaaat tatgtgactg      1500
     acagaccgcc gtgcagagaa atatgaacat gatttacttg caattagaac aaagctccaa      1560
     agtaatggat ttgttctccc caggcgttaa agttcatttc caaagccgtg catttcgttt      1620
     ttctttaagc agtcccagcc cataaaaagt gcacacataa taaacaacaa gccgctaaaa      1680
     ccaagtcaac atttcttagg tacaatttaa cctggcatct taaccagcat tgatttttcc      1740
     cccctttccc tccctcccct tttaattatg gcatgtgttt ggccacacag gcattacata      1800
     ttcagcgttc ttcagtcttt ttgtttgcta ggtggtggtt aatggtttaa atctagggtg      1860
     tcatttttct tgagaaaaat ccctaaatcc gtttttccta aaagctctgg ccaagagaga      1920
     actttaaggc agtttttgcc tccttgtggc tggcggtcac actaacggat ggccctgcat      1980
     actttgtgtt tgacgcaggt tctgggctga caaacatcaa gacggaagag atctcggaag      2040
     tgaagatgga tgcagaattc ggacatgatt caggatttga agtccgccat caaaaactgg      2100
     taggcaaaaa taaactgcct ctccccgaga ttgcgtctgg ccagatgaaa tacgtggcac      2160
     ctcgtggctt gtcctgtgtc aaaactgaga aggactactg ggaataaaac caaaatgcct      2220
     gcctagatct tcacaaagat aggaaggaga ggaagtgggg ctctgttgat agttcttgct      2280
     gagcagaagc cgctgagccc aggcgaacat acaagtgtaa ttcagtccaa cgttgcagct      2340
     acgtgagctg acttcctagg aaaatggttt tttcgggtta aacacatctt aatcccaata      2400
     tccaaactgg aaggcaggat accacaaaca agaaattcaa gtccatgagg ctctgatatt      2460
     actgtgtggg ggaagcataa gtgaatttca tttagaggtg gtcccagttt ccaagatggt      2520
     ctcattatgt aaataccaaa aaaaaaaaaa agttagaaat caagattttc gaaacccttt      2580
     tggtcatgac cattctcggt ccacgatagt tttatttgaa gaattggtct taaataagca      2640
     tgtggggagt acttggttgt agggatgctc tctcgcagtg cttggttaag ttctcatcta      2700
     caaatggata atttcagtcc attccaaccc ctcctccttc ctactgcttc cccacctccc      2760
     agtatttctt tggcttacaa gggaaagtta gcagagaccc tttaaggtga gtgaagccca      2820
     gcggtgactt tgccgcctca gcttctcagt cagaaatctt gggcaaggca gatagcagtt      2880
     tctctaaaga caaggcggtt ctcaatgtca gaattagaat gagtagagaa gcacgggtct      2940
     tccttatagg taggcggaga ttatataatt ctctaccaaa acctcagaaa ttcaaataag      3000
     ccaaattcca gatcgttaga gttccttcca tgttaccagt tatcacaata aaggacttga      3060
     gtgggaattt taaaaacggt aagaaaatac ctgtatagtg gtgcttgata agaactccag      3120
     ctctgtggtt gggtggagtg tgggagactg cagcctgatt cctttgtaaa gtatcttccc      3180
     agtgtttgta aataaaatgt gtagatccta gtatgaatct ccaaaagaaa gggcctttac      3240
     tgttgggctt ctcaattctg gattattgta gcaaatctaa agctggcttg ggattcaatt      3300
     ttgcattaat ttttttttcc ctttttttat tcagaaaaag gcacccagcc ttctgaaatg      3360
     tagttttcgt tggaaagttt attgctgttt tgttattgtg aaaccagagg cactcctgag      3420
     caggctgaaa ctgcaaggtt tcaaaacaaa tctggggtaa ctgctgaaag gctggctggg      3480
     ggtccggggc gtggctcgga agatgagtac caggatcccg tttttctgag ctggtgtcat      3540
     agacgccctt ctcagtaatt acatgaactt ctataatgcg acagtgacta atgacagccg      3600
     cagcaattag gggtatcagc tccctctact gcactagctg ataagataat gtactataat      3660
     tagtgcaatg aatattacag aattacagta tttccttaaa gacggaggga tatatccaga      3720
     ctcacattta ttcccgatca cctcactgta gtatcattag ttaattaatg atctccttta      3780
     ataaatgtgt tgagctagca tttttggttg gcgaggggat taattacgag ccatttctaa      3840
     ttttgccgca gatgcgctgt gagtaacatc cacttagaaa aattttatct gctctagttt      3900
     acctcgcctt tgcaaactgc agcagggatg gatttagcga tggaaatcgg tcattcacct      3960
     atcttgaagg ggcctggaaa gaattattta gggagctgtt ggcactaact tacataacaa      4020
     atgtgctcta gatcgttagg cacagctgcc cctccctccc tcgtttaacc caccatataa      4080
     gatcatctct tatataacaa gatgattaaa gtgcagtctg tatgtgttat ttcgcctaag      4140
     tagataaagc tgggaaccac tggcttgctt ttcaaaagag cgtggagacg tatgtataca      4200
     ctgcagagac tttctcaccg tgaatacatt tcttctttgt cacgttctca ggattctttt      4260
     ttatgttcaa tataaacaac cagagtaaag caatattgcc aattttggtt tctaggggca      4320
     actggataaa gtatgacttg tttgttacac tgagattctc tttgcctact gctgcttccc      4380
     ttggcaaaca tggcgctttt aaaggagagt atgcgttctg tggttaattg aatctatgta      4440
     ctattgtact atgaagaagg tagcttggct gtccttttct ctctgattaa ctcctgtgtt      4500
     tcagaacgtt ttttgaccca tatagaacat gtcccttcaa agaaagggaa gcatgcaggt      4560
     ttgaaaccta gctaagggga aagtcactgc tgtgggcagg aacggagtga cctgtttcca      4620
     gaacaatggc ggggacctct atttggtttt taccaaatgc ttacctgtta aagggcttca      4680
     gatccctgca gacttctacc tcatgatgca ccagagaaat tgacttcaga acccgggaag      4740
     ccacctgttg ctcattgttc cagagacgag gacgctcagt cctagggacc caccaactca      4800
     cccttcgctg agctatggcg gagggtcccc tgaaactttg ctacatccgt tgcctcttgc      4860
     gcttacagac ctttttctcg gcttcctttc gaaggtgttc tttgctgaag atgtgggttc      4920
     gaacaaaggc gccatcatcg gactcatggt gggcggcgtt gtcatagcaa ccgtgattgt      4980
     catcaccctg gtgatgttga agaagaaaca gtacacatcc atccatcatg gcgtggtgga      5040
     ggtaggtaaa cctggaggct tgtctgcaag tgggaggcaa gccaggaagt acaggcactg      5100
     gcccggggca cttaggagaa aagcaacatc cctctgtggt actcagggca cagctgctct      5160
     ctcgctgttt tgcatccacc cctgggtgcc atgaatttaa tgtgctctca ttaacattat      5220
     gcattgttac ttttaactta tgacttgtat tgaaattaac caaactaaga ctaattatga      5280
     cgctcagctt taaaaataca tgtatggttt ctcttaaata acaaaaatgg tatcagaagt      5340
     caaaaaaccg aacctagacc ttcatttctg atttgtattt tttgttgttt tgtttccccc      5400
     tctgattaga attaggtgat gataaataat actgattttt tttcagtaat gactcctagc      5460
     attaatttct ggaaggaagt ggcccagtag cgaatagctc agtatagcat gcgtggttac      5520
     catggaggaa cattcaggct gttgcctgaa cttccacctg agcagagatc gtagtttccg      5580
     gagttagtgg agaagcacag ggagtgtggg atgaggtaca cacgagccct tcacactgca      5640
     tatatctgga cttctttctg cccgcagagc agccaagcag ggacgcttac cacaaaagtc      5700
     agtgctacgt catcaaaaaa gtacaggact cgaatgtaac tccttccccg tcttgattcg      5760
     gggaagaaag agtgaaagga ggtagattca caaacattta aatatatttg tggtgacggg      5820
     aaagttttaa agcatccctg tgtgattaac ttttagatat ataatagtat aaccatctag      5880
     aacccaaaga cgccgagtcc agcagatctc attttgtagg tgagaaaagt cgatcaaata      5940
     aaaagaaccg cacagtgcca agcttaatac agtcagggtt tccccattct acccattgat      6000
     ttccatcaga ggccagtgtt aagtaagcat ctaattaaac ccgaagaaag tgctctaagc      6060
     catccttaat catacaaagg cagggacagt ttaataaact caagctaaag aaagccagag      6120
     atctcacatt cattggtcct tagattctcg acacttcatt cgtgaggatg ctcatgggaa      6180
     ttactgtggg ttttattttc ctgtcctagt tgatgtggat atacctaaag accagtgtgt      6240
     tgggtgaggc ccaggaaact gagggggcaa gaggcgaaag agctgaaaat ttcacacact      6300
     agagtataaa catgttttgt tttgtttcat ttttctcaaa gcaataactc tggggctgga      6360
     gagatatcca gtaaagtgtt tgccacacaa atgtaaggac ctgtgtttgg gtctgtagca      6420
     tcctcacaac acaccaggca caacataccc gggatgccag tactggagag agacacgtga      6480
     accaagggtt tgcaggaatc gtgttcgagg tccaagcccc tctctgggag actcaagaaa      6540
     taaggtggag agctttgaga aatgcctacc tacatcaacc tctggcctgc gcatgcacat      6600
     gtccacatgc aagagcatgt gtgtgtacat gcatacacac acacacacac acacacacac      6660
     acacacacac acacatgcac agataccaaa tttggggttt tgttctttct ataatggcac      6720
     ctaagttttg ttcttcaagg actgtaaaac attatctcca atgcatcttt ctctcgtttc      6780
     taatgaaatc tgttttcccc ctacttcaat cccctatttc gatatgcgaa taattcaaaa      6840
     actcctttga atttcattaa tagaattcaa tttaaatggt cttacagtgg aatgactctg      6900
     tccaagctgg gacttctgtc tgggaggaaa ataagtctgc caattcccat cttgatacca      6960
     caagccagag cctgtctctg cttgctgagt ctaccagcaa ggtaccccac agagagacca      7020
     cagacagagt ggatggcaca acaaaagtgt gctttcctga ccagtgatgg aggttagaag      7080
     tctgagacca ggctgta                                                     7097
//


spacer
spacer