spacer

EBI Dbfetch

ID   U79025; SV 1; linear; genomic DNA; STD; HUM; 260 BP.
XX
AC   U79025;
XX
DT   15-DEC-1996 (Rel. 50, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human isolate NORH01 MHC class II antigen HLA-DR gene (HLA-DRB1*1313
DE   allele), exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-260
RA   Hurley C.K., Noreen H., Lin Y.S.;
RT   "DRB1*1313";
RL   Unpublished.
XX
RN   [2]
RP   1-260
RA   Hurley C.K., Noreen H., Lin Y.S.;
RT   ;
RL   Submitted (20-NOV-1996) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd. NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; f4ee8a1d6ec3f22d675929cd7a1af2e6.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..260
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="NORH01"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1313,1202;DRB3*0301. DQA*05,0601;
FT                   DQB1*0301"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>260
FT                   /codon_start=3
FT                   /gene="HLA-DR"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DRB1*1313 allele"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAB52235.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDILEDRRALVDTYCRHNYGVGESFTV"
XX
SQ   Sequence 260 BP; 57 A; 62 C; 90 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg                                                   260
//


spacer
spacer