spacer

EBI Dbfetch

ID   U78539; SV 1; linear; mRNA; STD; MUS; 2708 BP.
XX
AC   U78539;
XX
DT   04-FEB-1997 (Rel. 50, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus hereditary multiple exostoses (Ext1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   submitted
RP   1-2708
RX   PUBMED; 9186511.
RA   Lohmann D.R., Buiting K., Ludecke H.J., Horsthemke B.;
RT   "The murine Ext1 gene shows a high level of sequence similarity with its
RT   human homologue and is part of a conserved linkage group on chromosome 15";
RL   Cytogenet. Cell Genet. 76(3-4):164-166(1997).
XX
RN   [2]
RP   1-2708
RA   Lohmann D.R., Buiting K., Luedecke H.-J., Horsthemke B.;
RT   ;
RL   Submitted (18-NOV-1996) to the INSDC.
RL   Humangenetik, Universitaet Essen, Hufelandstrasse 55, Essen D-45122,
RL   Germany
XX
DR   MD5; 95e5f298b03a206485df9310e32f8104.
DR   Ensembl-Gn; ENSMUSG00000061731; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077273; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2708
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="26.55 cM"
FT                   /strain="(B6 X CBA)F1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             325..2565
FT                   /codon_start=1
FT                   /gene="Ext1"
FT                   /function="confers hereditary predisposition to multiple
FT                   exostoses"
FT                   /db_xref="GOA:P97464"
FT                   /db_xref="InterPro:IPR004263"
FT                   /db_xref="InterPro:IPR015338"
FT                   /db_xref="InterPro:IPR027670"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:894663"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97464"
FT                   /protein_id="AAB41728.1"
FT                   /translation="MQAKKRYFILLSAGSCLALLFYFGGVQFRASRSHSRREEHSGRNG
FT                   LHQPSPDHFWPRFPDALRPFFPWDQLENEDSSVHISPRQKRDANSSIYKGKKCRMESCF
FT                   DFTLCKKNGFKVYVYPQQKGEKIAESYQNILAAIEGSRFYTSDPSQACLFVLSLDTLDR
FT                   DQLSPQYVHNLRSKVQSLHLWNNGRNHLIFNLYSGTWPDYTEDVGFDIGQAMLAKASIS
FT                   TENFRPNFDVSIPLFSKDHPRTGGERGFLKFNTIPPLRKYMLVFKGKRYLTGIGSDTRN
FT                   ALYHVHNGEDVLLLTTCKHGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGR
FT                   RLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQD
FT                   KILALRQQTQFLWEAYFSSVEKIVLTTLEIIQDRIFKHISRNSLIWNKHPGGLFVLPQY
FT                   SSYLGDFPYYYANLGLKPPSKFTAVIHAVTPLVSQSQPVLKLLVAAAKSQYCAQIIVLW
FT                   NCDKPLPAKHRWPATAVPVIVIEGESKVMSSRFLPYDNIITDAVLSLDEDTVLSTTEVD
FT                   FAFTVWQSFPERIVGYPARSHFWDNSKERWGYTSKWTNDYSMVLTGAAIYHKYYHYLYS
FT                   HYLPASLKNMVDQLANCEDILMNFLVSAVTKLPPIKVTQKKQYKETMMGQTSRASRWAD
FT                   PDHFAQRQSCMNTFASWFGYMPLIHSQMRLDPVLFKDQVSILRKKYRDIERL"
XX
SQ   Sequence 2708 BP; 705 A; 677 C; 663 G; 663 T; 0 other;
     ctctctttct tttcctccgt cttgttgcat gcaagaaaat tacagtccgc tgttcgcccg        60
     ccctgggtgc gagatcttct gcccggctct ctcccgtgca ttgtgcagcc caaagatgaa       120
     agaccgaagg ggagaaagtt aaagaaatcg cccacatgcg ctggatcagt ccacggcttg       180
     gggaaaggca tccagagaag gtgggagcgg agagtttgaa gtctttacag gcgggaagat       240
     ggcggactgg agctgaaagt gttgattggg aaacttgggt gattcttgtg tttatttaca       300
     atcctcttga cccaggcagg acacatgcag gccaaaaaac gctatttcat cctgctctca       360
     gctggctctt gtctcgccct tttgttttat tttggaggcg tgcagtttag ggcatcgagg       420
     agccacagcc ggagagaaga gcacagtggt cggaatggct tgcaccagcc cagtccggat       480
     catttctggc cccgcttccc ggacgctctg cgccctttct ttccttggga tcaattggaa       540
     aacgaggatt ccagcgtgca catttccccc cggcagaagc gagacgccaa ctcgagcatc       600
     tacaaaggca agaagtgccg catggagtcc tgcttcgatt tcaccctttg caagaaaaac       660
     ggcttcaaag tctacgtgta cccgcagcag aaaggggaga aaatcgccga aagttaccaa       720
     aacattctag cggccatcga gggctccagg ttctacacct cggaccccag ccaggcgtgc       780
     ctctttgtct tgagtctgga tactttagac agagaccagt tatcacctca gtatgtgcac       840
     aatttgagat ccaaagtgca gagtctccac ttgtggaaca atggtaggaa tcatttaatt       900
     tttaatttat attctggcac ttggcctgac tacactgagg acgtggggtt tgacatcggc       960
     caggcgatgc tggccaaagc cagcatcagt actgaaaact tccgaccaaa ctttgatgtt      1020
     tctattcccc tcttttctaa ggatcatccc aggacaggag gggagagggg gtttttgaaa      1080
     tttaacacca tccctcctct caggaagtac atgctggtat tcaaggggaa gcggtacctg      1140
     acagggatag ggtcagacac caggaatgcc ttatatcacg tccataacgg ggaggacgtc      1200
     ttgctcctca ccacctgcaa gcatggcaaa gactggcaaa agcacaagga ttctcgctgt      1260
     gacagagaca acaccgagta tgagaaatat gattatcggg aaatgctgca caatgccact      1320
     ttctgtctgg ttcctcgtgg tcgcaggctt gggtccttca gattcctgga ggctttgcag      1380
     gctgcctgtg tccctgtaat gctcagcaac ggatgggagt tgccattctc cgaagtgatt      1440
     aattggaacc aagctgccgt cataggcgat gagagattgc tattacagat tccttctaca      1500
     atcaggtcta ttcatcagga taaaatccta gcacttagac agcagacaca gttcttgtgg      1560
     gaggcttatt tttcttcagt tgagaagatt gtattaacta cactagagat tattcaggac      1620
     agaatattca agcacatatc acgtaacagt ttaatatgga acaaacatcc tggaggattg      1680
     ttcgtcctac cgcagtattc atcttacctg ggagatttcc cttactacta tgctaattta      1740
     ggtttaaagc ccccctccaa attcactgca gtcatccatg ctgtgactcc cctggtctct      1800
     cagtcccagc cagtgttgaa gcttcttgtg gctgcagcca aatcccagta ctgtgcgcag      1860
     atcatagttc tgtggaattg tgacaagcct ctaccagcca aacatcgctg gcctgccact      1920
     gccgtgcctg tcatcgtcat tgaaggagaa agcaaggtta tgagcagccg gtttctgccc      1980
     tatgacaaca tcatcactga tgctgtgctc agcctggatg aggacactgt gctttcaact      2040
     acggaagtgg attttgcctt caccgtatgg cagagcttcc cagagaggat tgtgggatat      2100
     cctgctcgca gtcatttctg ggataactca aaggagcggt ggggatatac atccaagtgg      2160
     acgaatgact actccatggt gttgacagga gctgctatct accacaaata ttatcactac      2220
     ctgtattccc attacctgcc agccagcctg aagaacatgg tagaccaact ggccaactgt      2280
     gaggacattc tcatgaattt cctggtgtct gctgtgacaa aattgcctcc aatcaaagtg      2340
     acccagaaga aacagtataa ggagacaatg atgggacaga cttcccgagc atcccgctgg      2400
     gccgaccctg accactttgc ccagcgacag agctgcatga atacatttgc cagctggttt      2460
     ggctacatgc cgctgatcca ttctcagatg aggctggacc cggtcctctt taaagaccaa      2520
     gtctcaattc tgaggaagaa atacagagac attgaacgac tttgaggaag cccaccgagt      2580
     gggggagggg aagcaagacg ggcgtccagc tgctctctcc tccttcccaa tgcagatccg      2640
     ctcacgccca gcagtggagc cagactgtgc caagtatcaa aaaatcaaaa aaaaaaaaaa      2700
     aaaaaaaa                                                               2708
//


spacer
spacer