spacer

EBI Dbfetch

ID   U76832; SV 1; linear; mRNA; STD; MUS; 897 BP.
XX
AC   U76832;
XX
DT   18-NOV-1996 (Rel. 49, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus plasma membrane protein syntaxin-4 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-897
RX   DOI; 10.1074/jbc.272.10.6179.
RX   PUBMED; 9045631.
RA   Tellam J.T., Macaulay S.L., McIntosh S., Hewish D.R., Ward C.W.,
RA   James D.E.;
RT   "Characterization of Munc-18c and syntaxin-4 in 3T3-L1 adipocytes. Putative
RT   role in insulin-dependent movement of GLUT-4";
RL   J Biol Chem 272(10):6179-6186(1997).
XX
RN   [2]
RP   1-897
RA   Tellam J.T., James D.E.;
RT   ;
RL   Submitted (31-OCT-1996) to the INSDC.
RL   Centre for Molecular and Cellular Biology, University of Queensland, Sir
RL   Fred Schonnell Drive, St. Lucia, Brisbane, QLD 4072, Australia
XX
DR   MD5; 259f4cfa7c07d7705c230c17c4b6f00a.
DR   Ensembl-Gn; ENSMUSG00000030805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033075; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121705; mus_musculus.
DR   EuropePMC; PMC28121; 9861047.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..897
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /cell_type="3T3-L1 adipocytes"
FT                   /db_xref="taxon:10090"
FT   CDS             1..897
FT                   /codon_start=1
FT                   /product="plasma membrane protein syntaxin-4"
FT                   /note="neural syntaxin-1A homolog"
FT                   /db_xref="GOA:P70452"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="MGI:MGI:893577"
FT                   /db_xref="PDB:3PUJ"
FT                   /db_xref="PDB:3PUK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70452"
FT                   /protein_id="AAB18991.1"
FT                   /translation="MRDRTHELRQGDNISDDEDEVRVALVVHSGAARLGSPDDEFFQKV
FT                   QTIRQTMAKLESKVRELEKQQVTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAI
FT                   EPQKEEADENYNSVNTRMKKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKIT
FT                   NAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHE
FT                   IFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKKARKKKVMIAICVS
FT                   VTVLILAVIIGITITVG"
XX
SQ   Sequence 897 BP; 252 A; 204 C; 279 G; 162 T; 0 other;
     atgcgcgaca ggacccacga gttgaggcag ggggataaca tctcagacga tgaagatgag        60
     gttcgagtcg cgctggtggt gcactcaggt gctgcccggt tgggcagccc ggacgacgag       120
     ttcttccaga aggtgcagac aattcggcag actatggcca aactggagag taaagtccgg       180
     gagttggaga aacagcaggt caccatcctg gccacgcctc ttcccgagga gagcatgaag       240
     cagggcctgc agaacctgcg agaggagatc aaacagctgg ggagagaggt ccgggcgcag       300
     ctaaaagcca tagagcccca gaaggaggaa gctgatgaga attacaactc agtcaacaca       360
     aggatgaaga aaacccagca tggagtcctg tcccagcaat ttgtcgagct catcaacaag       420
     tgcaactcaa tgcagtccga ataccgagag aagaatgtgg agcggatccg gaggcagctg       480
     aagatcacca atgctggaat ggtgtctgac gaggagctgg aacagatgct ggacagtggg       540
     cagagtgagg tgtttgtgtc taatatcctg aaggacacgc aggtgactcg gcaggccctg       600
     aatgagatct ctgcgcggca cagtgagatc cagcagttgg agcgcagtat ccgagagctc       660
     catgagatct ttacgtttct agctacggag gtggagatgc agggggagat gatcaaccgc       720
     atcgagaaga acatcctgag ctcggccgac tacgtggaac gtgggcaaga gcacgtcaag       780
     atagccctag agaatcagaa gaaggcgagg aagaaaaaag tcatgattgc catctgtgtc       840
     tctgtcactg ttctcatctt ggctgtcatc attggcatca ccataaccgt tggataa          897
//


spacer
spacer