spacer

EBI Dbfetch

ID   U74683; SV 3; linear; mRNA; STD; MUS; 1969 BP.
XX
AC   U74683;
XX
DT   02-JUN-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus dipeptidyl peptidase I precursor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1767
RX   DOI; 10.1016/S0167-4781(97)00021-3.
RX   PUBMED; 9130590.
RA   McGuire M.J., Lipsky P.E., Thiele D.L.;
RT   "Cloning and characterization of the cDNA encoding mouse dipeptidyl
RT   peptidase I (cathepsin C)";
RL   Biochim. Biophys. Acta 1351(3):267-273(1997).
XX
RN   [2]
RP   1-1767
RA   McGuire M.J., Lipsky P.E., Thiele D.L.;
RT   ;
RL   Submitted (16-OCT-1996) to the INSDC.
RL   Internal Medicine, UT Southwestern, 5323 Harry Hines Blvd, Dallas, TX
RL   75235, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-1969
RA   McGuire M.J., Lipsky P.E., Francisco N.M.C., Thiele D.L.;
RT   ;
RL   Submitted (19-APR-2000) to the INSDC.
RL   Internal Medicine, UT Southwestern, 5323 Harry Hines Blvd, Dallas, TX
RL   75235, USA
XX
DR   MD5; d92004570db0648213e8d0bcb5dd3116.
DR   Ensembl-Gn; ENSMUSG00000030560; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032779; mus_musculus.
DR   EuropePMC; PMC149931; 12576554.
DR   EuropePMC; PMC1734521; 10662807.
DR   EuropePMC; PMC33252; 11320206.
XX
CC   On Apr 19, 2000 this sequence version replaced gi:7609692.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1969
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /cell_line="XS52 dendritic cell line"
FT                   /note="identical sequence obtained from DBA/2 strain"
FT                   /db_xref="taxon:10090"
FT   sig_peptide     68..757
FT   CDS             68..1456
FT                   /codon_start=1
FT                   /product="dipeptidyl peptidase I precursor"
FT                   /note="cysteine protease; cathepsin C; DPPI"
FT                   /db_xref="GOA:P97821"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR013128"
FT                   /db_xref="InterPro:IPR014882"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR025661"
FT                   /db_xref="MGI:MGI:109553"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97821"
FT                   /protein_id="AAB58400.3"
FT                   /translation="MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGP
FT                   RSSRSDINCSVMEATEEKVVVHLKKLDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAF
FT                   FKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGKKVESHIEKVNMNAAHLGGLQERY
FT                   SERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSGHSQRIPRPKPAPMTDE
FT                   IQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTPI
FT                   LSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYY
FT                   SSDYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPF
FT                   ELTNHAVLLVGYGRDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIP
FT                   IPKL"
FT   mat_peptide     758..1453
FT                   /product="dipeptidyl peptidase I"
XX
SQ   Sequence 1969 BP; 542 A; 433 C; 441 G; 553 T; 0 other;
     actgccatcg agtggtgttc cagttgaact tgctctctct gccatctgct ccgcgggcgc        60
     cgtcagcatg ggtccctgga cccactcctt gcgcgccgtc ctgctgctgg tgcttttggg       120
     agtctgcacc gtgcgctccg acactcctgc caactgcacc taccctgatc tgctgggcac       180
     ctgggtgttc caggtgggcc ctagaagttc ccgaagcgac attaactgct cggtgatgga       240
     agcaacagaa gaaaaggtag tggtacacct taagaagttg gatactgcct acgacgagct       300
     gggcaattcc gggcatttta ccctcattta caaccaaggc ttcgagattg tgttgaatga       360
     ctacaaatgg tttgcgtttt tcaagtatga agtcagaggc cacacagcta tcagttactg       420
     ccatgagacc atgactgggt gggtccatga tgtgctgggc cggaactggg cttgctttgt       480
     tggcaagaag gtggaaagtc acattgagaa ggttaatatg aatgcagcac atcttggagg       540
     tctccaggaa agatattctg aaagactcta cactcacaac cacaactttg tgaaggccat       600
     caataccgtt cagaagtctt ggactgcaac tgcatataag gaatatgaga aaatgagcct       660
     gcgagatctg ataaggagaa gtggccacag ccaaaggatc ccaaggccca aacctgcccc       720
     gatgactgat gaaatacagc aacaaatttt aaatttgcca gaatcttggg actggagaaa       780
     cgtccaaggc gtcaattatg ttagccctgt tcgaaaccaa gaatcttgtg gaagctgcta       840
     ctcatttgcc tctatgggta tgctagaagc aagaattcgt atattaacca acaattctca       900
     gacaccaatc ctgagtcctc aggaggttgt atcttgcagc ccctatgccc aaggttgtga       960
     tggtggattc ccatacctca ttgcagggaa gtatgcccaa gattttgggg tggtggaaga      1020
     aagctgcttt ccctacacag ccaaagattc tccatgcaaa ccaagggaga attgcctccg      1080
     ttactattct tctgactact actatgtggg tggtttctat ggtggctgca atgaagccct      1140
     gatgaagctt gagctggtca aacatggacc catggcagtt gcctttgaag tccacgatga      1200
     cttcctacac taccacagtg gaatctatca ccacactggg ctgagtgacc ctttcaaccc      1260
     cttcgagctg acaaatcatg ctgttttgct tgtgggctat ggaagagatc cagttactgg      1320
     gatagaatac tggattataa agaacagctg gggctctaac tggggggaga gtggctactt      1380
     ccgtatccgc agaggaactg atgaatgtgc aattgagagt atagccgtgg cggccatacc      1440
     gattcctaaa ttataggaca tagctcccag tgttacatac gggtctttat cactcacaga      1500
     gtgatttagt cacatgctga agactttttc agagcaatat cagaagctta ccactaagca      1560
     tctttaaaga attttgtctt tgaacttaaa accatccttg atttttttct tttaatatct      1620
     tccccatcaa ctactgaact acttttcttt ttaaagtact tggttaagta atacttttat      1680
     gagcagtggt tcagttgtcc aatatttttt gcaggtcatc tacaatgcaa ccagatgttt      1740
     cagttctaaa aatctatgta aaagtacaag ctcgttttta aattatgtaa gtcacatgaa      1800
     aacatggcaa aaaaattagt taaatttttt acaaagagtt ttaaataaat gtttatgtaa      1860
     tcagtaccat agtctttcta tgtgtgttta caagaatttt tgtcacctac ttcttccctt      1920
     agaagcattt atgctccatg gacgtacttc tttatggaga aaaaaaaaa                  1969
//


spacer
spacer