spacer

EBI Dbfetch

ID   U73520; SV 1; linear; genomic DNA; STD; MUS; 2344 BP.
XX
AC   U73520;
XX
DT   19-NOV-1996 (Rel. 49, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus bone morphogenetic protein-6 (BMP-6) gene, exons 6 and 7 and
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2344
RA   Gitelman S.E., Kobrin M., Lee A., Lyons K., Fen V., Hogan B.L.M.,
RA   Derynck R.;
RT   "Structure and sequence of the mouse Bmp6 gene";
RL   Mamm. Genome 0:0-0(1996).
XX
RN   [2]
RP   1-2344
RA   Gitelman S.E., Kobrin M., Lee A., Lyons K., Fen V., Hogan B.L.M.,
RA   Derynck R.;
RT   ;
RL   Submitted (07-OCT-1996) to the INSDC.
RL   Pediatrics, UCSF, Box 0136 500 Parnassus Avenue, San Francisco, CA 94143,
RL   USA
XX
DR   MD5; 99d4a211eb163bd7db2cd80ba5316857.
DR   Ensembl-Gn; ENSMUSG00000039004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171970; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2344
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(U73515.1:1730..2384,U73516.1:103..295,
FT                   U73517.1:106..254,U73518.1:166..363,U73519.1:70..146,
FT                   35..145,237..386)
FT                   /codon_start=1
FT                   /gene="BMP-6"
FT                   /product="bone morphogenetic protein-6"
FT                   /note="cDNA sequence deposited under GenBank Accession
FT                   Number X80992; Vg-1 related protein, Vgr-1"
FT                   /db_xref="GOA:P20722"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR002405"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:88182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20722"
FT                   /protein_id="AAB18235.1"
FT                   /translation="MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAG
FT                   GSPVRAEQPPPQSSSSGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQPPVL
FT                   PPQQQQQQQQQQTAREEPPPGRLKSAPLFMLDLYNALSNDDEEDGASEGVGQEPGSHGG
FT                   ASSSQLRQPSPGAAHSLNRKSLLAPGPGGGASPLTSAQDSAFLNDADMVMSFVNLVEYD
FT                   KEFSPHQRHHKEFKFNLSQIPEGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQ
FT                   HRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRA
FT                   AGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSD
FT                   YNGSELKTACKKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIV
FT                   QTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH"
FT   exon            35..145
FT                   /gene="BMP-6"
FT                   /number=6
FT   exon            237..>386
FT                   /gene="BMP-6"
FT                   /number=7
XX
SQ   Sequence 2344 BP; 611 A; 580 C; 551 G; 602 T; 0 other;
     ggatccttca ctgcttcctt ttgctttatc taaggactgg atcattgcac ccaaaggcta        60
     cgctgccaac tactgtgatg gagagtgttc cttcccactc aacgcacaca tgaatgccac       120
     caaccacgcc attgtacaga ccttggtgag tgctccaacc cggctgtaaa tgggatcgag       180
     cctagatctg gtgtcatttc taacagtgcc ctcccacact tctattctgg aaacaggtcc       240
     accttatgaa tcccgagtac gtccccaaac catgctgcgc accaaccaaa ctgaatgcca       300
     tctcggttct ttacttcgat gataactcca atgtcatctt gaaaaagtac aggaatatgg       360
     tcgtgagagc ttgtggttgc cattaagttg aagctggtgt gtgtgtgtgg gtgggggcat       420
     ggttctgcct tggattccta acaacaacat ctgccttaaa ccacgaacaa cagcacagcg       480
     aagcgggatg gtgacacaca gagggatcgt gacacgcaga cacatctccc gctggtgcct       540
     tacccacgga ggcttttatg aggaccttgt caagggcttt cccagttcct aactgagcag       600
     ttgctggtct gcaggaagct ggaaggcttg tagtacaggc ctggaaactg cagttaccta       660
     atgttcgcct cccccaaccc cgcccggagt agttttagct tttagatcta gctgcttgtg       720
     gtgtaagtag agagtaaact tgaaggaata ttaaatatcc ctgggttgaa agacccggtg       780
     gtggctctac agcacccatc ccagggagat ttttgcagac atccgaatgg aggggagaag       840
     ggcactcttt caggttccat tcccagcaag ggcagctcac acaggacctg cagcctggcc       900
     atcagcaggc tctgtggagg tgccttctgt ctactgttgt agttacgtgt tttgtgttga       960
     ctctcggtgg tgtgagaatg tactaatctc tgtcaagaca aactgtagca tttccacccc      1020
     atcctcctcc ctccctcaca gaattcttta ctagaaccca aagtagacag accgtacttt      1080
     gtggcagagc catgaagcat ctgccgtagc cgtcatttaa gccacagaac agcagaattt      1140
     gattctacat ctcgtgggca gcctggctgg acatgcgtgt taacatcagg aacactggct      1200
     ccaacatcgg ctctgtaacc cctaactctg ctctttgcct tttccctacc taagcattcc      1260
     atggctcagg gctagagtct aaagccgaaa cccagagagg gaagggccct gcctgtaaga      1320
     atgggtttgt caaggtgagc atgctgtgtg taaaccaaaa ccaccatttc ctcctgtaga      1380
     aagtaagact cagactgaat cttagaatat tttttaaatg tccttttcac aatcatgtac      1440
     cgggaagcca atttcatact aaactgatta aataatacat ttacaatctg taactgtact      1500
     tacagccttc tttgtaaata gaaactataa tttattgtct attttatatc cattttgctg      1560
     taacatttaa gcaaagacca gacttttttt ctttaaaaaa aaaaagttta tttagaaagt      1620
     ataaaccaaa ttgtaccact tgagttttct tttcatataa gaccatgatg ctaagctgaa      1680
     gccactgtga gctgggccaa cagaactggt ttccaaggac agctgtgacc cacacgtgat      1740
     taataataaa cgttcataac aggctggcgg ggcgcctctg ctcctgatgt tttggaagca      1800
     gacgtggtct ggtttcaagt ctccttgcta catgtcttgt gccaggtgct gatttcaccc      1860
     cgctcgtggg aggtaggtga agggcctggg cacaaacaca gtggttctga gaacaagaca      1920
     gacagaggca tgacgtgggc tgcatcttca cagagttacg agcagcggcg tctaataacc      1980
     tggaaggcgg gaaccggaag tagccatgcg atatccaacc ttgggcttcc taggcaaggg      2040
     cagccctgcc gactgcagtc tttggtctgg aggtcagatg aatcccactg ctcaatcatt      2100
     agagagatgg tcagcctcct ttaaggtgga gattataaag cgagctgcta aaagaactac      2160
     ttaggaagag aatcagaagc tgtttctagg aaggcccgag aggagctgca gagactccct      2220
     ggtccttgga cctgggaaag cctatcgggt gaggacccac cttgtggtgc atcccatacc      2280
     ctccctttct gcagaagacg tacatctcca cactccaccc tatgcgaagc agacaagagg      2340
     atcc                                                                   2344
//


spacer
spacer