spacer

EBI Dbfetch

ID   U72264; SV 1; linear; genomic DNA; STD; HUM; 253 BP.
XX
AC   U72264;
XX
DT   22-OCT-1996 (Rel. 49, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Human MHC class II antigen (HLA-DRB1) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-253
RA   Greville W.D., Bowman S.;
RT   "New HLA class II (DRB1) allele from Melbourne BTS";
RL   Unpublished.
XX
RN   [2]
RP   1-253
RA   Greville W.D., Bowman S.;
RT   ;
RL   Submitted (23-SEP-1996) to the INSDC.
RL   Molecular Genetics Department, NSW Red Cross Blood Transfusion Service, 153
RL   Clarence street, Sydney, NSW 2000, Australia
XX
DR   MD5; cb2777ecf27d0f5b8c315857632b0da2.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..253
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="DAS094"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>253
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:30"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAB17276.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAVT
FT                   ELGRPSAEYWNSQKDILEDRRAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 253 BP; 55 A; 60 C; 88 G; 50 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tagcgccgag tactggaaca gccagaagga       180
     catcctggaa gacaggcggg ccgcggtgga cacctactgc agacacaact acggggttgg       240
     tgagagcttc aca                                                          253
//


spacer
spacer