spacer

EBI Dbfetch

ID   U70430; SV 1; linear; genomic RNA; STD; MUS; 3511 BP.
XX
AC   U70430;
XX
DT   05-APR-1997 (Rel. 51, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 4)
XX
DE   Mus musculus interleukin-4 induced gene-1 partially spliced (Fig1ps)
DE   precursor RNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3511
RX   DOI; 10.1073/pnas.94.6.2507.
RX   PUBMED; 9122225.
RA   Chu C.C., Paul W.E.;
RT   "Fig1, an interleukin 4-induced mouse B cell gene isolated by cDNA
RT   representational difference analysis";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(6):2507-2512(1997).
XX
RN   [2]
RP   1-3511
RA   Chu C.C., Paul W.E.;
RT   ;
RL   Submitted (11-SEP-1996) to the INSDC.
RL   Lab. of Immunology, NIAID, Building 10, Room 11N311, Bethesda, MD
RL   20892-1892, USA
XX
DR   MD5; 5906f54904b21933b7f50c2c7648004a.
DR   Ensembl-Gn; ENSMUSG00000074141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033015; mus_musculus.
DR   EuropePMC; PMC1230979; 16177382.
DR   EuropePMC; PMC20118; 9122225.
DR   EuropePMC; PMC3157898; 21628331.
DR   EuropePMC; PMC434242; 15226448.
DR   EuropePMC; PMC538991; 15618193.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3511
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="between Klk1 and Ldh3"
FT                   /mol_type="genomic RNA"
FT                   /cell_type="B cell"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   source          1..811
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="genomic RNA"
FT                   /note="5' RACE, and cDNA representational difference
FT                   analysis"
FT                   /db_xref="taxon:10090"
FT   source          423..3511
FT                   /organism="Mus musculus"
FT                   /strain="CBA/J"
FT                   /mol_type="genomic RNA"
FT                   /note="Clontech IL-4 induced splenic B cell cDNA library"
FT                   /db_xref="taxon:10090"
FT   source          913..1349
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="genomic RNA"
FT                   /note="5' RACE, and cDNA representational difference
FT                   analysis"
FT                   /db_xref="taxon:10090"
FT   source          2075..2377
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="genomic RNA"
FT                   /note="5' RACE, and cDNA representational difference
FT                   analysis"
FT                   /db_xref="taxon:10090"
FT   precursor_RNA   1..3511
FT                   /gene="Fig1"
FT                   /note="interleukin-four induced gene-1"
FT   mRNA            join(1..412,913..1114,2075..3511)
FT                   /gene="Fig1"
FT                   /product="Fig-1 protein"
FT                   /note="interleukin-four induced gene-1"
FT   misc_feature    1..3511
FT                   /gene="Fig1"
FT   exon            1..412
FT                   /gene="Fig1"
FT                   /number=1
FT   5'UTR           1..50
FT                   /gene="Fig1"
FT   CDS             join(51..412,913..1114,2075..3403)
FT                   /codon_start=1
FT                   /gene="Fig1"
FT                   /product="Fig-1 protein"
FT                   /note="interleukin-four induced gene-1; similar to some
FT                   flavoproteins, most specifically to monomaine oxidases"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAB51354.1"
FT                   /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   misc_feature    299..300
FT                   /gene="Fig1"
FT                   /note="putative additional splice site; deduced from 5'
FT                   RACE clones"
FT   intron          413..912
FT                   /gene="Fig1"
FT                   /number=1
FT   misc_feature    913..1349
FT                   /gene="Fig1"
FT                   /note="DNA fragment in clone 20-8T#17"
FT   exon            913..1114
FT                   /gene="Fig1"
FT                   /number=2
FT   misc_feature    913..1114
FT                   /gene="Fig1"
FT                   /note="5' end of DNA fragment in clone 20-8T#22"
FT   intron          1115..2074
FT                   /gene="Fig1"
FT                   /number=2
FT   exon            2075..3511
FT                   /gene="Fig1"
FT                   /number=3
FT   misc_feature    2075..2377
FT                   /gene="Fig1"
FT                   /note="3' end of DNA fragment in clone 20-8T#22"
FT   misc_feature    2143..2144
FT                   /gene="Fig1"
FT                   /note="putative additional splice site; deduced from
FT                   genomic fragment (U80211)"
FT   3'UTR           3404..3511
FT                   /gene="Fig1"
FT   variation       3460
FT                   /gene="Fig1"
FT                   /replace="a"
FT                   /citation=[1]
FT   polyA_signal    3482..3487
FT                   /gene="Fig1"
FT   variation       3502..3503
FT                   /gene="Fig1"
FT                   /replace="ccac"
FT                   /citation=[1]
XX
SQ   Sequence 3511 BP; 762 A; 1053 C; 972 G; 724 T; 0 other;
     gtctgcagtc ctgcccaaga gagctgaaga cagcagctgc cacttgagcc atggctgggc        60
     tggccctgcg tcttgtcctg gcggccaccc tccttggtct ggcaggctct ctggactgga       120
     aggcagcctc cagcttgaac cctattgaga agtgtatgga ggaccacgat tatgagcagc       180
     tactcaaggt ggtgaccttg ggcctcaatc ggacttcgaa gccccagaag gtggtagtgg       240
     ttggtgcagg cgtggcaggg ctggtagcag ccaagatgct cagtgatgca ggacacaagg       300
     tcaccatcct ggaggcagat aacaggattg ggggccgtat cttcactttc cgggatgaga       360
     agacaggctg gataggggag cttggggcca tgcgaatgcc cagctctcac aggtgaggtc       420
     ccacctaccc aggcagcaga gccccacctc tacaccaagg tttagccaga gcccagttcc       480
     atacccactc ccacattttg ccaactcccg tcccaaattc aggctcagcc aatcccagcc       540
     tcattcttgg tctgggctca accagaagca agctctatcc ccagtccagg caccagtatc       600
     tgtgttttga ggtaatgctt atagaacttt gggcttcaag ctacacctcc aactcatctc       660
     cagtttcacc cctattcgca cccagtcaaa agttgggtct agaccttact tccactcaca       720
     cccctcagta ctgccttccg gagagcccgg gtgatcagtg ccctagcctg caagctgcct       780
     gagctctgcc cctatcccca ccccgactcc tgagccagcc ctcaggtccc cagtgagtag       840
     tctgatgccc atctccagtg gccctcttat ggtgccaggc caggcctctc tcaagcagcc       900
     tcccacttct aggatcttgc acaagctctg caggaccctg ggcctcaacc tgactcagtt       960
     cacacagtat gatgagaaca cgtggacgga ggtgcataat gtgaagctgc gaaactatgt      1020
     ggtggagaag atgccagaaa agctgggcta caacctgaac aacagggaaa ggggccattc      1080
     cccagaggac atctaccaga tggcactcaa caaggtggcc accggctttc ctgcagagct      1140
     cagccctgcc cccaagagtc ttgtgtctac tactatcacg tctgctgatg gctagcgggt      1200
     gttttctcca tccctccagc tcacccacta ctgtagcccc tggcactcac tcccaggacc      1260
     ctccagcaac actgctactc tgtgtcccca tctgcttgac tcggacagtg ctgtcagaca      1320
     tcaccctctt ttcgtgtccc aaaaggatct ttccatccag atgatcctgc ctacaactcc      1380
     atgtacctcc ccagtgcctc tcaggcccat gagccagacc agctttccct ctccttagtc      1440
     cacctggtga gccaggcata ccctcctctg ctcctggaac ccaaccttcc tcatccatca      1500
     cccctaagtc tgtatcctcg acttccacct tacccatgac aaggaggtct aggtaaagag      1560
     gctggaggcc atgtttggaa ggagctcaaa gatcactaaa tgccaggctg gagagcctgc      1620
     atatagcagg ggaggcagcc ctgctctcta tactttagaa ctacaactgc cttctgcaag      1680
     aaagggttaa cggaggcagc tggtccttgg gggccagtag aggtgggact ctagtggttc      1740
     ctcctggggg tgggggtggg gagctaaggg aagttgtggg tgagggggga cactactgaa      1800
     tagtctttgc tggtagtatc atcctcttgg actgtgagag gccctcacct gcctatgccc      1860
     acaatggtct agacaatgat ctctactggc ttgccctcac tggcctgcac aaaaacacac      1920
     gctactgctg actgggtgga cagacaggga aacccagtat ttggaggact cccgcttcag      1980
     agcaggtgta tgcatcatga gctaatgcct gggacctgaa gtgaggtaaa ttgctgttcc      2040
     tgctgcaaca agggtcctct gattgtcccc acaggccttc aaagacctca aggccttggg      2100
     ctgcaagaaa gccatgaata agttcaacaa gcatacgctt ctggaatacc tcctcgagga      2160
     gggcaacctg tcccggccgg ctgtgcagct cctgggagat gtgatgtccg aggagggctt      2220
     cttctacctc agctttgcag aagccttacg tgcgcacgcc tgcctgagcg atagactccg      2280
     gtacagccgc atcgtaggtg gctgggacct gcttccgcga gctctgctga gctcactgtc      2340
     cggggcgctg ctactgaacg cgcctgtggt gtcgatcact caggggagga acgatgtacg      2400
     cgtgcacatt gccacctcgc ttcacagcga gaagacgctg acagccgacg tggtgctgct      2460
     gactgccagt ggacccgcgc tgcagcgcat taccttctcg ccgcccttga ctcgcaagag      2520
     gcaggaggca ctgcgcgcgc ttcactacgt agcagccagc aaggtttttc tgagtttccg      2580
     tcggcccttc tggcacgagg agcacatcga gggcggccac tccaacactg accgcccatc      2640
     gcgcctcata ttctatcccg cgcggggcga gggctcactg cttctggcct cctacacgtg      2700
     gtcggacgct gcagccccct tcgctggact gagcaccgac cagaccctgc gtttggtgct      2760
     ccaggacgtg gcggccctgc acgggcctgt ggtgttccgg ctgtgggacg gcaggggtgt      2820
     ggtcaagcgc tgggcagagg acccgcatag ccagggaggc ttcgtggtgc agccgccatt      2880
     gtacgggcgc gaggctgagg actatgactg gtcagccccc ttcggccgca tttacttcgc      2940
     gggcgagcac acagctctcc cgcatggctg ggtagagacc gctgtcaagt ccgggttgcg      3000
     ggccgcggtg agaatcaata ataactatgg gtacggggag gtcgaccccc agatgatgga      3060
     gcatgcatat gcagaggcca actatctgga ccagtatcct gaaggggaga ggcccgagga      3120
     gcagcaggcg cgggaagaag tcagcccaga tgaacaggag ccctctcaca aacacttgtt      3180
     ggtggaaacg agccccgagg ggcagcaaca cgcgtttgtg gaggccattc ccgagctgca      3240
     gggacacgtg ttcgtggaga ctgtccccca ggagaagggg cacgcccacc agaatatata      3300
     tccttcggag catgtacagg tgcatgggga agtcatccct gagtggcatg gtcatggggg      3360
     atctggcacc ccgcaaatgc accgagtggg ggaccactcc taatcgcaaa gaggaagtga      3420
     gcacccagct cctaagccag ccctcttcag ggcagacagg ccacctacac taatagccca      3480
     caataaagtt atttttgtta aaaaaaaaaa a                                     3511
//


spacer
spacer