spacer

EBI Dbfetch

ID   U70429; SV 1; linear; mRNA; STD; MUS; 2059 BP.
XX
AC   U70429;
XX
DT   05-APR-1997 (Rel. 51, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus interleukin-4 induced gene-1 (Fig1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2059
RX   DOI; 10.1073/pnas.94.6.2507.
RX   PUBMED; 9122225.
RA   Chu C.C., Paul W.E.;
RT   "Fig1, an interleukin 4-induced mouse B cell gene isolated by cDNA
RT   representational difference analysis";
RL   Proc. Natl. Acad. Sci. U.S.A. 94(6):2507-2512(1997).
XX
RN   [2]
RP   1-2059
RA   Chu C.C., Paul W.E.;
RT   ;
RL   Submitted (11-SEP-1996) to the INSDC.
RL   Laboratory of Immunology, NIAID, Building 10, Room 11N311, Bethesda, MD
RL   20892-1892, USA
XX
DR   MD5; 7ac1bc0091c367c987b3d128102de96e.
DR   EuropePMC; PMC20118; 9122225.
DR   EuropePMC; PMC529166; 15557650.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2059
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="between Klk1 and Ldh3"
FT                   /mol_type="mRNA"
FT                   /cell_type="B cell"
FT                   /tissue_type="spleen"
FT                   /db_xref="taxon:10090"
FT   source          1..917
FT                   /organism="Mus musculus"
FT                   /strain="BALB/C"
FT                   /mol_type="mRNA"
FT                   /note="5' RACE, and cDNA representational difference
FT                   analysis"
FT                   /db_xref="taxon:10090"
FT   source          537..2059
FT                   /organism="Mus musculus"
FT                   /strain="CBA/J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Clontech IL-4 induced splenic B cell cDNA
FT                   library"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..50
FT                   /gene="Fig1"
FT   CDS             51..1943
FT                   /codon_start=1
FT                   /gene="Fig1"
FT                   /product="Fig-1 protein"
FT                   /note="interleukin-four induced gene-1; similar to some
FT                   flavoproteins, most specifically to monoamine oxidases"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAB51353.1"
FT                   /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   sig_peptide     51..113
FT                   /gene="Fig1"
FT                   /note="encodes hydrophobic domain as predicted by the GES
FT                   (Goldman, Engelman and Steitz) method"
FT   misc_feature    171..173
FT                   /gene="Fig1"
FT                   /note="encodes tyrosine 41, a putative tyrosine
FT                   phosphorylation site (KXXEXXXY)"
FT   misc_feature    207..467
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to many
FT                   FAD-binding and NAD-binding proteins"
FT   misc_feature    207..215
FT                   /gene="Fig1"
FT                   /note="encodes putative N-linked glycosylation site (NXT)"
FT   misc_feature    228..314
FT                   /gene="Fig1"
FT                   /note="encodes putative FAD-binding domain 1 by similarity
FT                   to beta-alpha-beta dinucleotide fold; binds ADP"
FT   misc_feature    231..287
FT                   /gene="Fig1"
FT                   /note="encodes hydrophobic domain as predicted by the GES
FT                   method"
FT   misc_feature    299..300
FT                   /gene="Fig1"
FT                   /note="splice site; deduced from 5' RACE clones"
FT   misc_feature    327..350
FT                   /gene="Fig1"
FT                   /note="encodes putative FAD-binding domain 2 by similarity
FT                   to monoamine oxidase B; binds ribityl moiety"
FT   misc_feature    412..413
FT                   /gene="Fig1"
FT                   /note="splice site; deduced from precursor RNA (Fig1ps,
FT                   U70430)"
FT   misc_feature    414..917
FT                   /gene="Fig1"
FT                   /note="DNA fragment in clone 20-8T#22"
FT   misc_feature    414..614
FT                   /gene="Fig1"
FT                   /note="5' end of DNA fragment in clone 20-8T#17"
FT   misc_feature    447..455
FT                   /gene="Fig1"
FT                   /note="encodes putative N-linked glycosylation site (NXT)"
FT   misc_feature    549..551
FT                   /gene="Fig1"
FT                   /note="encodes tyrosine 167, a putative tyrosine
FT                   phosphorylation site (KXXEXXXY)"
FT   misc_feature    614..615
FT                   /gene="Fig1"
FT                   /note="splice site; deduced from precrsor RNA (Fig1ps,
FT                   U70430)"
FT   misc_feature    683..684
FT                   /gene="Fig1"
FT                   /note="splice site; deduced from genomic fragment (U80211)"
FT   misc_feature    705..713
FT                   /gene="Fig1"
FT                   /note="encodes putative N-linked glycosylation site (NXT)"
FT   misc_feature    828..944
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to monoamine
FT                   oxidase B"
FT   misc_feature    858..908
FT                   /gene="Fig1"
FT                   /note="encodes hydrophobic domain as predicted by the GES
FT                   method"
FT   misc_feature    894..914
FT                   /gene="Fig1"
FT                   /note="encodes putative FAD-binding domain 3 by similarity
FT                   to dinucleotide fold"
FT   misc_feature    972..1025
FT                   /gene="Fig1"
FT                   /note="encodes hydrophobic domain as predicted by the GES
FT                   method"
FT   misc_feature    972..1016
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to Arabidopsis
FT                   thaliana phytoene desaturase"
FT   misc_feature    984..1010
FT                   /gene="Fig1"
FT                   /note="encodes putative FAD-binding domain 4 by similarity
FT                   to dinucleotide fold"
FT   misc_feature    1026..1142
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to monoamine
FT                   oxidase B"
FT   misc_feature    1119..1259
FT                   /gene="Fig1"
FT                   /note="encodes possible active site by similarity to
FT                   fumarate reductase/succinate dehydrogenase (FRD/SDH) family
FT                   of proteins"
FT   misc_feature    1206..1271
FT                   /gene="Fig1"
FT                   /note="encodes hydrophobic domain as predicted by the GES
FT                   method"
FT   misc_feature    1218..1328
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to tryptophan
FT                   2-monooxygenase"
FT   misc_feature    1365..1571
FT                   /gene="Fig1"
FT                   /note="encodes putative FAD-binding domain 5 by similarity
FT                   to monoamine oxidase; binds FAD"
FT   misc_feature    1365..1496
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to monoamine
FT                   oxidase B"
FT   misc_feature    1509..1571
FT                   /gene="Fig1"
FT                   /note="encodes a region which is similar to monoamine
FT                   oxidase B"
FT   3'UTR           1944..2059
FT                   /gene="Fig1"
FT   variation       2000
FT                   /gene="Fig1"
FT                   /replace="g"
FT                   /note="compare to Fig1ps sequence in GenBank Accession
FT                   Number U70430"
FT                   /citation=[1]
FT   regulatory      2022..2027
FT                   /gene="Fig1"
FT                   /regulatory_class="polyA_signal_sequence"
FT   variation       2043..2046
FT                   /gene="Fig1"
FT                   /note="deletion of ccac; compare to Fig1ps sequence in
FT                   GenBank Accession Number U70430"
FT                   /citation=[1]
FT   polyA_site      2047..2059
FT                   /gene="Fig1"
XX
SQ   Sequence 2059 BP; 460 A; 581 C; 636 G; 382 T; 0 other;
     gtctgcagtc ctgcccaaga gagctgaaga cagcagctgc cacttgagcc atggctgggc        60
     tggccctgcg tcttgtcctg gcggccaccc tccttggtct ggcaggctct ctggactgga       120
     aggcagcctc cagcttgaac cctattgaga agtgtatgga ggaccacgat tatgagcagc       180
     tactcaaggt ggtgaccttg ggcctcaatc ggacttcgaa gccccagaag gtggtagtgg       240
     ttggtgcagg cgtggcaggg ctggtagcag ccaagatgct cagtgatgca ggacacaagg       300
     tcaccatcct ggaggcagat aacaggattg ggggccgtat cttcactttc cgggatgaga       360
     agacaggctg gataggggag cttggggcca tgcgaatgcc cagctctcac aggatcttgc       420
     acaagctctg caggaccctg ggcctcaacc tgactcagtt cacacagtat gatgagaaca       480
     cgtggacgga ggtgcataat gtgaagctgc gaaactatgt ggtggagaag atgccagaaa       540
     agctgggcta caacctgaac aacagggaaa ggggccattc cccagaggac atctaccaga       600
     tggcactcaa caaggccttc aaagacctca aggccttggg ctgcaagaaa gccatgaata       660
     agttcaacaa gcatacgctt ctggaatacc tcctcgagga gggcaacctg tcccggccgg       720
     ctgtgcagct cctgggagat gtgatgtccg aggagggctt cttctacctc agctttgcag       780
     aagccttacg tgcgcacgcc tgcctgagcg atagactccg gtacagccgc atcgtaggtg       840
     gctgggacct gcttccgcga gctctgctga gctcactgtc cggggcgctg ctactgaacg       900
     cgcctgtggt gtcgatcact caggggagga acgatgtacg cgtgcacatt gccacctcgc       960
     ttcacagcga gaagacgctg acagccgacg tggtgctgct gactgccagt ggacccgcgc      1020
     tgcagcgcat taccttctcg ccgcccttga ctcgcaagag gcaggaggca ctgcgcgcgc      1080
     ttcactacgt agcagccagc aaggtttttc tgagtttccg tcggcccttc tggcacgagg      1140
     agcacatcga gggcggccac tccaacactg accgcccatc gcgcctcata ttctatcccg      1200
     cgcggggcga gggctcactg cttctggcct cctacacgtg gtcggacgct gcagccccct      1260
     tcgctggact gagcaccgac cagaccctgc gtttggtgct ccaggacgtg gcggccctgc      1320
     acgggcctgt ggtgttccgg ctgtgggacg gcaggggtgt ggtcaagcgc tgggcagagg      1380
     acccgcatag ccagggaggc ttcgtggtgc agccgccatt gtacgggcgc gaggctgagg      1440
     actatgactg gtcagccccc ttcggccgca tttacttcgc gggcgagcac acagctctcc      1500
     cgcatggctg ggtagagacc gctgtcaagt ccgggttgcg ggccgcggtg agaatcaata      1560
     ataactatgg gtacggggag gtcgaccccc agatgatgga gcatgcatat gcagaggcca      1620
     actatctgga ccagtatcct gaaggggaga ggcccgagga gcagcaggcg cgggaagaag      1680
     tcagcccaga tgaacaggag ccctctcaca aacacttgtt ggtggaaacg agccccgagg      1740
     ggcagcaaca cgcgtttgtg gaggccattc ccgagctgca gggacacgtg ttcgtggaga      1800
     ctgtccccca ggagaagggg cacgcccacc agaatatata tccttcggag catgtacagg      1860
     tgcatgggga agtcatccct gagtggcatg gtcatggggg atctggcacc ccgcaaatgc      1920
     accgagtggg ggaccactcc taatcgcaaa gaggaagtga gcacccagct cctaagccag      1980
     ccctcttcag ggcagacaga ccacctacac taatagccca caataaagtt atttttgtta      2040
     aaccacaaaa aaaaaaaaa                                                   2059
//


spacer
spacer