Dbfetch

ID   U68058; SV 1; linear; mRNA; STD; MUS; 2176 BP.
XX
AC   U68058;
XX
DT   07-DEC-1996 (Rel. 50, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus frezzled (fre) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2176
RX   DOI; 10.1016/S0092-8674(00)81921-2.
RX   PUBMED; 9118218.
RA   Leyns L., Bouwmeester T., Kim S.H., Piccolo S., De Robertis E.M.;
RT   "Frzb-1 is a secreted antagonist of Wnt signaling expressed in the Spemann
RT   organizer";
RL   Cell 88(6):747-756(1997).
XX
RN   [2]
RP   1-2176
RA   Leyns L., Bouwmeester T., Kim S.-H., Piccolo S., De Robertis E.M.;
RT   ;
RL   Submitted (26-AUG-1996) to the INSDC.
RL   Biological Chemistry, HHMI/UCLA, 675 Circle Drive South, Los Angeles, CA
RL   90095-1662, USA
XX
DR   MD5; a423e493d9ffc7c2e16e2a1efe545d0f.
DR   Ensembl-Gn; ENSMUSG00000027004; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028389; mus_musculus.
DR   EuropePMC; PMC3061830; 9118218.
XX
CC   Expressed in adult mouse in heart, brain, spleen, skeletal muscle,
CC   kidney and testis RNA; in the embryo, it is expressed in the
CC   primitive streak of the gastrula, head endoderm and posterior
CC   mesoderm.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2176
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             13..984
FT                   /codon_start=1
FT                   /gene="frezzled"
FT                   /product="frezzled"
FT                   /note="secreted antagonist of Wnt signalling; shows
FT                   similarity to Drosophila frizzled cystein-rich domain"
FT                   /db_xref="GOA:P97401"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026556"
FT                   /db_xref="MGI:MGI:892032"
FT                   /db_xref="PDB:1IJX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97401"
FT                   /protein_id="AAC53135.1"
FT                   /translation="MVCCGPGRMLLGWAGLLVLAALCLLQVPGAQAAACEPVRIPLCKS
FT                   LPWNMTKMPNHLHHSTQANAILAMEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEP
FT                   IKPCKSVCERARQGCEPILIKYRHSWPESLACDELPVYDRGVCISPEAIVTADGADFPM
FT                   DSSTGHCRGASSERCKCKPVRATQKTYFRNNYNYVIRAKVKEVKMKCHDVTAVVEVKEI
FT                   LKASLVNIPRDTVNLYTTSGCLCPPLTVNEEYVIMGYEDEERSRLLLVEGSIAEKWKDR
FT                   LGKKVKRWDMKLRHLGLGKTDASDSTQNQKSGRNSNPRPARS"
XX
SQ   Sequence 2176 BP; 563 A; 501 C; 521 G; 591 T; 0 other;
     aagcctggga ccatggtctg ctgcggcccg ggacggatgc tgctaggatg ggccgggttg        60
     ctagtcctgg ctgctctctg cctgctccag gtgcccggag ctcaggctgc agcctgtgag       120
     cctgtccgca tcccgctgtg caagtccctt ccctggaaca tgaccaagat gcccaaccac       180
     ctgcaccaca gcacccaggc taacgccatc ctggccatgg aacagttcga agggctgctg       240
     ggcacccact gcagcccgga tcttctcttc ttcctctgtg caatgtacgc acccatttgc       300
     accatcgact tccagcacga gcccatcaag ccctgcaagt ctgtgtgtga gcgcgcccga       360
     cagggctgcg agcccattct catcaagtac cgccactcgt ggccggaaag cttggcctgc       420
     gacgagctgc cggtgtacga ccgcggcgtg tgcatctctc ctgaggccat cgtcaccgcg       480
     gacggagcgg attttcctat ggattcaagt actggacact gcagaggggc aagcagcgaa       540
     cgttgcaaat gtaagcctgt cagagctaca cagaagacct atttccggaa caattacaac       600
     tatgtcatcc gggctaaagt taaagaggta aagatgaaat gtcatgatgt gaccgccgtt       660
     gtggaagtga aggaaattct aaaggcatca ctggtaaaca ttccaaggga caccgtcaat       720
     ctttatacca cctctggctg cctctgtcct ccacttactg tcaatgagga atatgtcatc       780
     atgggctatg aagacgagga acgttccagg ttactcttgg tagaaggctc tatagctgag       840
     aagtggaagg atcggcttgg taagaaagtc aagcgctggg atatgaaact ccgacacctt       900
     ggactgggta aaactgatgc tagcgattcc actcagaatc agaagtctgg caggaactct       960
     aatccccggc cagcacgcag ctaaatcctg aaatgtaaaa ggccacaccc acggactccc      1020
     ttctaagact ggcgctggtg gactaacaaa ggaaaaccgc acagttgtgc tcgtgaccga      1080
     ttgtttaccg cagacaccgc gtggctaccg aagttacttc cggtcccctt tctcctgctt      1140
     cttaatggcg tggggttaga tcctttaata tgttatatat tctgtttcat caatcacgtg      1200
     gggactgttc ttttgcaacc agaatagtaa attaaatatg ttgatgctaa ggtttctgta      1260
     ctggactccc tgggtttaat ttggtgttct gtaccctgat tgagaatgca atgtttcatg      1320
     taaagagaga atcctggtca tatctcaaga actagatatt gctgtaagac agcctctgct      1380
     gctgcgctta tagtcttgtg tttgtatgcc tttgtccatt tccctcatgc tgtgaaagtt      1440
     atacatgttt ataaaggtag aacggcattt tgaaatcaga cactgcacaa gcagagtagc      1500
     ccaacaccag gaagcattta tgaggaaacg ccacacagca tgacttattt tcaagattgg      1560
     caggcagcaa aataaatagt gttgggagcc aagaaaagaa tattttgcct ggttaagggg      1620
     cacactggaa tcagtagccc ttgagccatt aacagcagtg ttcttctggc aagtttttga      1680
     tttgttcata aatgtattca cgagcattag agatgaactt ataactagac atctgttgtt      1740
     atctctatag ctctgcttcc ttctaaatca aacccattgt tggatgctcc ctctccattc      1800
     ataaataaat ttggcttgct gtattggcca ggaaaagaaa gtattaaagt atgcatgcat      1860
     gtgcaccagg gtgttattta acagaggtat gtaactctat aaaagactat aatttacagg      1920
     acacggaaat gtgcacattt gtttactttt tttcttcctt ttgctttggg cttgtgattt      1980
     tggtttttgg tgtgtttatg tctgtatttt ggggggtggg taggtttaag ccattgcaca      2040
     ttcaagttga actagattag agtagactag gctcattggc ctagacatta tgatttgaat      2100
     ttgtgttgtt taatgctcca tcaagatgtc taataaaagg aatatggttg tcaacagaga      2160
     cgacaacaac aacaaa                                                      2176
//