spacer

EBI Dbfetch

ID   U67188; SV 1; linear; mRNA; STD; MUS; 2397 BP.
XX
AC   U67188;
XX
DT   03-JUN-1997 (Rel. 52, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus G protein signaling regulator RGS5 (rgs5) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2397
RX   DOI; 10.1074/jbc.272.13.8679.
RX   PUBMED; 9079700.
RA   Chen C., Zheng B., Han J., Lin S.-C.;
RT   "Characterization of a novel mammalian RGS protein that binds to Galpha
RT   proteins and inhibits pheromone signaling in yeast";
RL   J Biol Chem 272(13):8679-8685(1997).
XX
RN   [2]
RP   1-2397
RA   Lin S.-C.;
RT   ;
RL   Submitted (19-AUG-1996) to the INSDC.
RL   Institute of Molecular and Cell Biology, National University of Singapore,
RL   10 Kent Ridge Crescent, Singapore 119260, Republic of Singapore
XX
DR   MD5; b05bdcac482a74355896e73e5383d422.
DR   Ensembl-Gn; ENSMUSG00000026678; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027997; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2397
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             35..580
FT                   /codon_start=1
FT                   /gene="rgs5"
FT                   /product="G protein signaling regulator RGS5"
FT                   /note="contains an RGS domain; expressed in heart and
FT                   muscle"
FT                   /db_xref="GOA:O08850"
FT                   /db_xref="InterPro:IPR000342"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1098434"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08850"
FT                   /protein_id="AAB50618.1"
FT                   /translation="MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPE
FT                   KPANGHKPSLEEVLQWRQSLDKLLQNSYGFATFKSFLKSEFSEENLEFWVACENYKKIK
FT                   SPIKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSPRSFDLAQKRIYALME
FT                   KDSLPRFVRSEFYKELIK"
XX
SQ   Sequence 2397 BP; 657 A; 594 C; 555 G; 591 T; 0 other;
     cgcctcaagt tgaggatcta agccgccagc caaaatgtgt aagggactgg cagctctgcc        60
     gcactcatgc ctggaaaggg ccaaggagat caagatcaag ttgggaattc tcctccagaa       120
     gccagactct gctgttgacc ttgtcattcc atacaatgag aagccagaga agcctgccaa       180
     cggacacaag ccctcactgg aggaggtcct gcagtggcgc cagtccctgg acaagcttct       240
     ccagaacagc tatggatttg ccacgttcaa aagtttcctg aagtctgaat tcagtgagga       300
     aaaccttgag ttctgggttg cctgtgagaa ttacaagaag atcaagtccc ccatcaaaat       360
     ggcggagaag gcaaagcaaa tttatgaaga attcatccag acagaggccc ctaaagaggt       420
     gaacattgac cacttcacta aagacatcac catgaagaac ctggtggaac cgtctcctcg       480
     cagctttgac ttggcccaga aaaggatcta tgccctgatg gagaaggatt ctctgccccg       540
     ctttgtgcgc tctgaatttt ataaggagct aatcaagtag tcatctggtc aggcttccaa       600
     aagttgaaat gtgagttgag ttacatcctt tgtagcaaca cagcatcctc ccaggcacct       660
     gcacagttct ccatagcagc tttgctccaa gatacacaaa cataggcaaa ccacaggctg       720
     tgttgctaac tctttcgctc atgttagttt ggttatgtgg atctgttgtc taagagccct       780
     cacttttttc tttttcgttc gcctcaagtt gaggatctaa gccgccagcc aaaatgtgta       840
     agggactggc agctctgccg cactcatgcc tggaaagggc caaggagatc aagatcaagt       900
     tgggaattct cctccagaag ccagactctg ctgttgacct tgtcattcca tacaatgaga       960
     agccagagaa gcctgccaac ggacacaagc cctcactgga ggaggtcctg cagtggcgcc      1020
     agtccctgga caagcttctc cagaacagct atggatttgc cacgttcaaa agtttcctga      1080
     agtctgaatt cagtgaggaa aaccttgagt tctgggttgc ctgtgagaat tacaagaaga      1140
     tcaagtcccc catcaaaatg gcggagaagg caaagcaaat ttatgaagaa ttcatccaga      1200
     cagaggcccc taaagaggtg aacattgacc acttcactaa agacatcacc atgaagaacc      1260
     tggtggaacc gtctcctcgc agctttgact tggcccagaa aaggatctat gccctgatgg      1320
     agaaggattc tctgccccgc tttgtgcgct ctgaatttta taaggagcta atcaagtagt      1380
     catctggtca ggcttccaaa agttgaaatg tgagttgagt tacatccttt gtagcaacac      1440
     agcatcctcc caggcacctg cacagttctc catagcagct ttgctccaag atacacaaac      1500
     ataggcaaac cacaggctgt gttgctaact ctttcgctca tgttagtttg gttatgtgga      1560
     tctgttgtct aagagccctc acttttttct ttttcgttcg cctcaagttg aggatctaag      1620
     ccgccagcca aaatgtgtaa gggactggca gctctgccgc actcatgcct ggaaagggcc      1680
     aaggagatca agatcaagtt gggaattctc ctccagaagc cagactctgc tgttgacctt      1740
     gtcattccat acaatgagaa gccagagaag cctgccaacg gacacaagcc ctcactggag      1800
     gaggtcctgc agtggcgcca gtccctggac aagcttctcc agaacagcta tggatttgcc      1860
     acgttcaaaa gtttcctgaa gtctgaattc agtgaggaaa accttgagtt ctgggttgcc      1920
     tgtgagaatt acaagaagat caagtccccc atcaaaatgg cggagaaggc aaagcaaatt      1980
     tatgaagaat tcatccagac agaggcccct aaagaggtga acattgacca cttcactaaa      2040
     gacatcacca tgaagaacct ggtggaaccg tctcctcgca gctttgactt ggcccagaaa      2100
     aggatctatg ccctgatgga gaaggattct ctgccccgct ttgtgcgctc tgaattttat      2160
     aaggagctaa tcaagtagtc atctggtcag gcttccaaaa gttgaaatgt gagttgagtt      2220
     acatcctttg tagcaacaca gcatcctccc aggcacctgc acagttctcc atagcagctt      2280
     tgctccaaga tacacaaaca taggcaaacc acaggctgtg ttgctaactc tttcgctcat      2340
     gttagtttgg ttatgtggat ctgttgtcta agagccctca cttttttctt tttcgtt         2397
//


spacer
spacer