Dbfetch

ID   U67187; SV 1; linear; mRNA; STD; MUS; 1240 BP.
XX
AC   U67187;
XX
DT   03-JUN-1997 (Rel. 52, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus G protein signaling regulator RGS2 (rgs2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1240
RX   DOI; 10.1074/jbc.272.13.8679.
RX   PUBMED; 9079700.
RA   Chen C., Zheng B., Han J., Lin S.-C.;
RT   "Characterization of a novel mammalian RGS protein that binds to Galpha
RT   proteins and inhibits pheromone signaling in yeast";
RL   J Biol Chem 272(13):8679-8685(1997).
XX
RN   [2]
RP   1-1240
RA   Lin S.-C.;
RT   ;
RL   Submitted (19-AUG-1996) to the INSDC.
RL   Institute of Molecular and Cell Biology, National University of Singapore,
RL   10 Kent Ridge Crescent, Singapore 119260, Republic of Singapore
XX
DR   MD5; e026c198afbcff444d96cc964edb2a15.
DR   Ensembl-Gn; ENSMUSG00000026360; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016548; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016333; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016307; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016411; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016437; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015698; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015975; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000127206; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022966; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021791; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022338; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022306; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021832; mus_musculus_wsbeij.
DR   EuropePMC; PMC1553470; 16822311.
DR   EuropePMC; PMC15989; 10716996.
DR   EuropePMC; PMC2518899; 18559972.
DR   EuropePMC; PMC3157898; 21628331.
DR   EuropePMC; PMC517445; 15322042.
DR   EuropePMC; PMC523004; 15501793.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1240
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             21..656
FT                   /codon_start=1
FT                   /gene="rgs2"
FT                   /product="G protein signaling regulator RGS2"
FT                   /note="contains an RGS domain; expressed in a wide variety
FT                   of tissues"
FT                   /db_xref="GOA:O08849"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="MGI:MGI:1098271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08849"
FT                   /protein_id="AAB50617.1"
FT                   /translation="MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLNHWKTRL
FT                   SYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEAHVWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT"
XX
SQ   Sequence 1240 BP; 373 A; 263 C; 303 G; 301 T; 0 other;
     ggccgcgcgg gagtctgaga atgcaaagtg ccatgttcct ggctgtccag cacgactgcg        60
     tacccatgga caagagtgca ggcaacggcc ccaaggtcga ggagaagcgg gagaaaatga       120
     agcggacact cttaaaccat tggaagaccc gtttgagcta cttcttgcag aattcctctg       180
     ctcctgggaa gcccaaaact ggcaagaaaa gcaaacagca aacttttatc aagccttctc       240
     ctgaggaagc gcacgtctgg gcagaagcat ttgatgaact gctggccagt aaatatgggc       300
     tggctgcatt cagggcgttt ttaaagtccg agttctgtga agaaaacatt gaattctggt       360
     tggcttgtga agacttcaaa aaaaccaaat caccccaaaa actgtcctca aaagcaagga       420
     aaatctatac cgacttcata gagaaggaag ctcccaaaga gataaacata gacttccaaa       480
     cgaaatctct gattgcccaa aatatccaag aggctacaag tggctgcttc accacagctc       540
     agaagagggt gtacagtttg atggagaaca attcttatcc tcggttcttg gagtccgaat       600
     tctaccagga cttatgtaaa aagccacaga tcaccacgga gccccatgct acatgagacc       660
     aggagtcccc ccacacacaa aggacattcc attctgtctc ccaagagcaa aggctgtgac       720
     ctgccagaaa aaaaaaaaaa actgaccttg aattcagcct gagtgttagg aaaacatcgc       780
     tcagaactat tgattcaatg ttgggtagtg aatcaggaag tcagcaacct aggagaggct       840
     ctgtgtgaga acggcttccc tcactgtgtg aagaacagag ggagggaaca ggcctctgaa       900
     tgtgttcttc ctccttgtcg ggaaagcaga gtttgagatg aaagatccga tgcaatgttg       960
     ttggagcatt taaaatcaag aggtctggga ttatgtggcc ttagctagtt ggctgtacac      1020
     cttccctaaa ctagtccatg ttacacatag tggtgttagt tctagtttta atattttagt      1080
     actaagtaac attacaatgt ttactgtgtg caagggtgtt gacgttctta ggactacaga      1140
     tcattagtac tagtgtgtca cgtatcactg aaactgagaa gtatgtttga gttgttaaat      1200
     ggtgtgtgtg atggaccgaa tgctgtgccg tgctgtagaa                            1240
//