spacer

EBI Dbfetch

ID   U66828; SV 1; linear; mRNA; STD; HUM; 2610 BP.
XX
AC   U66828;
XX
DT   21-JAN-1997 (Rel. 50, Created)
DT   18-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Human carnitine palmitoyltransferase I (CPTI) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2610
RX   DOI; 10.1006/abbi.1997.0314.
RX   PUBMED; 9344464.
RA   Zhu H., Shi J., de Vries Y., Arvidson D.N., Cregg J.M., Woldegiorgis G.;
RT   "Functional studies of yeast-expressed human heart muscle carnitine
RT   palmitoyltransferase I";
RL   Arch. Biochem. Biophys. 347(1):53-61(1997).
XX
RN   [2]
RP   1-2610
RA   Woldegiorgis G.;
RT   ;
RL   Submitted (13-AUG-1996) to the INSDC.
RL   Oregon Graduate Institute of Science & Technology, Chemistry, Biochemistry
RL   and Mol. Biol., Portland, OR 97291-1000, USA
XX
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000440709; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2610
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /dev_stage="adult"
FT                   /clone="HHCPTI"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:9606"
FT   5'UTR           <1..38
FT                   /gene="CPTI"
FT   CDS             39..2357
FT                   /codon_start=1
FT                   /gene="CPTI"
FT                   /product="carnitine palmitoyltransferase I"
FT                   /function="fatty acid transport across mitochondrial
FT                   membrane"
FT                   /EC_number="2.3.1.21"
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000220992.12"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92523"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAB40651.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIR
FT                   IKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTR
FT                   ALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRH
FT                   PMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKY
FT                   LVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAM
FT                   IMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHK
FT                   GRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAF
FT                   FSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFT
FT                   LISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTR
FT                   LQWDIPKQCQAVIESSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQL
FT                   AHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQK
FT                   AAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQI
FT                   RMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNH
FT                   IRKALLDIADLFQVPKAYS"
FT   3'UTR           2358..2610
FT                   /gene="CPTI"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   polyA_site      2583..2588
FT                   /gene="CPTI"
XX
SQ   Sequence 2610 BP; 563 A; 764 C; 726 G; 557 T; 0 other;
     gcaattccca ccgcggaagg tgccgaccaa cccccaggat ggcggaagct caccaggccg        60
     tggccttcca gttcacggtg accccagacg gggtcgactt ccggctcagt cgggaggccc       120
     tgaaacacgt ctacctgtct gggatcaact cctggaagaa acgcctgatc cgcatcaaga       180
     atggcatcct caggggcgtg taccctggca gccccaccag ctggctggtc gtcatcatgg       240
     caacagtggg ttcctccttc tgcaacgtgg acatctcctt ggggctggtc agttgcatcc       300
     agagatgcct ccctcagggg tgtggcccct accagacccc gcagacccgg gcacttctca       360
     gcatggccat cttctccacg ggcgtctggg tgacgggcat cttcttcttc cgccaaaccc       420
     tgaagctgct tctctgctac catgggtgga tgtttgagat gcatggcaag accagcaact       480
     tgaccaggat ctgggctatg tgtatccgcc ttctatccag ccggcaccct atgctctaca       540
     gcttccagac atctctgccc aagcttcctg tgcccagggt gtcagccaca attcagcggt       600
     acctagagtc tgtgcgcccc ttgttggatg atgaggaata ttaccgcatg gagttgctgg       660
     ccaaagaatt ccaggacaag actgccccca ggctgcagaa atacctggtg ctcaagtcat       720
     ggtgggcaag taactatgtg agtgactggt gggaagagta catctacctt cgaggcagga       780
     gccctctcat ggtgaacagc aactattatg tcatggacct tgtgctcatc aagaatacag       840
     acgtgcaggc agcccgcctg ggaaacatca tccacgccat gatcatgtat cgccgtaaac       900
     tggaccgtga agaaatcaag cctgtgatgg cactgggcat agtgcctatg tgctcctacc       960
     agatggagag gatgttcaac accactcgga tcccgggcaa ggacacagat gtgctacagc      1020
     acctctcaga cagccggcac gtggctgtct accacaaggg acgcttcttc aagctgtggc      1080
     tctatgaggg cgcccgtctg ctcaagcctc aggatctgga gatgcagttc cagaggatcc      1140
     tggacgaccc ctccccacct cagcctgggg aggagaagct ggcagccctc actgcaggag      1200
     gaagggtgga gtgggcgcag gcacgccagg ccttctttag ctctggaaag aataaggctg      1260
     ccttggaggc catcgagcgt gccgctttct tcgtggccct ggatgaggaa tcctactcct      1320
     atgaccccga agatgaggcc agcctcagcc tctatggcaa ggccctgcta catggcaact      1380
     gctacaacag gtggtttgac aaatccttca ctctcatttc cttcaagaat ggccagttgg      1440
     gtctcaatgc agagcatgcg tgggcagatg ctcccatcat tgggcacctc tgggagtttg      1500
     tcctgggcac agacagcttc cacctgggct acacggagac cgggcactgc ctgggcaaac      1560
     cgaaccctgc gctcgcacct cctacacggc tgcagtggga cattccaaaa cagtgccagg      1620
     cggtcatcga gagttcctac caggtggcca aggcgttggc agacgacgtg gagttgtact      1680
     gcttccagtt cctgcccttt ggcaaaggcc tcatcaagaa gtgccggacc agccctgatg      1740
     cctttgtgca gatcgcgctg cagctggctc acttccggga caggggtaag ttctgcctga      1800
     cctatgaggc ctcaatgacc agaatgttcc gggagggacg gactgagact gtgcgttcct      1860
     gtaccagcga gtccacagcc tttgtgcagg ccatgatgga ggggtcccac acaaaagcag      1920
     acctgcgaga tctcttccag aaggctgcta agaagcacca gaatatgtac cgcctggcca      1980
     tgaccggggc agggatcgac aggcacctct tctgccttta cttggtctcc aagtacctag      2040
     gagtcagctc tcctttcctt gctgaggtgc tctcggaacc ctggcgtctc tccaccagcc      2100
     agatccccca atcccagatc cgcatgttcg acccagagca gcaccccaat cacctgggcg      2160
     ctggaggtgg ctttggccct gtagcagatg atggctatgg agtttcctac atgattgcag      2220
     gcgagaacac gatcttcttc cacatctcca gcaagttctc aagctcagag acgaacgccc      2280
     agcgctttgg aaaccacatc cgcaaagccc tgctggacat tgctgatctt ttccaagttc      2340
     ccaaggccta cagctgaagg ttggagaaat gccagctgcc ctttcgtccc cacactgtgg      2400
     aggaagggac ctgtggcagc tcacaggcat gaggggtggc cgtgcacagg tgcccaggct      2460
     ccaaggacag ctccggcagc aggtcctcgc tgggcagatg ctgctccctg agggcccagg      2520
     tggtggaggt ggggttggag caggaaggga attttgattt tttttttttc ttgatagata      2580
     ctaataaaaa taaggctgtg taattttctc                                       2610
//


spacer
spacer