spacer

EBI Dbfetch

ID   U62733; SV 1; linear; mRNA; STD; HUM; 2576 BP.
XX
AC   U62733;
XX
DT   19-JAN-1997 (Rel. 50, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Human carnitine palmitoyltransferase I mRNA, nuclear gene encoding
DE   mitochondrial protein, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2576
RX   DOI; 10.1006/geno.1996.4539.
RX   PUBMED; 9070950.
RA   Britton C.H., Mackey D.W., Esser V., Foster D.W., Burns D.K., Yarnall D.P.,
RA   Froguel P., McGarry J.D.;
RT   "Fine chromosome mapping of the genes for human liver and muscle carnitine
RT   palmitoyltransferase I (CPT1A and CPT1B)";
RL   Genomics 40(1):209-211(1997).
XX
RN   [2]
RP   1-2576
RA   Britton C.H.;
RT   ;
RL   Submitted (01-JUL-1996) to the INSDC.
RL   Internal Medicine, University of Texas Southwestern Medical Center at
RL   Dallas, 5323 Harry Hines Blvd., Dallas, TX 75235, USA
XX
DR   Ensembl-Gn; ENSG00000205560; homo_sapiens.
DR   Ensembl-Tr; ENST00000312108; homo_sapiens.
DR   Ensembl-Tr; ENST00000360719; homo_sapiens.
DR   Ensembl-Tr; ENST00000395650; homo_sapiens.
DR   Ensembl-Tr; ENST00000405237; homo_sapiens.
DR   Ensembl-Tr; ENST00000440709; homo_sapiens.
DR   Ensembl-Tr; ENST00000457250; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2576
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="muscle"
FT                   /db_xref="taxon:9606"
FT   5'UTR           1..46
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT   CDS             47..2365
FT                   /codon_start=1
FT                   /product="carnitine palmitoyltransferase I"
FT                   /function="mitochondrial fatty acid import"
FT                   /db_xref="GOA:Q92523"
FT                   /db_xref="H-InvDB:HIT000220732.12"
FT                   /db_xref="HGNC:HGNC:2329"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92523"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAC51122.1"
FT                   /translation="MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIR
FT                   IKNGILRGVYPGSPTSWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTR
FT                   ALLSMAIFSTGVWVTGIFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRH
FT                   PMLYSFQTSLPKLPVPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKY
FT                   LVLKSWWASNYVSDWWEEYIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAM
FT                   IMYRRKLDREEIKPVMALGIVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHK
FT                   GRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAF
FT                   FSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFT
FT                   LISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTR
FT                   LQWDIPKQCQAVIKSSYQVAKALADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQL
FT                   AHFRDRGKFCLTYEASMTRMFREGRTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQK
FT                   AAKKHQNMYRLAMTGAGIDRHLFCLYLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQI
FT                   RMFDPEQHPNHLGAGGGFGPVADDGYGVSYMIAGENTIFFHISSKFSSSETNAQRFGNH
FT                   IRKALLDIADLFQVPKAYS"
FT   3'UTR           2366..2576
XX
SQ   Sequence 2576 BP; 553 A; 769 C; 703 G; 551 T; 0 other;
     ccgcgcaccc atctgccccc gtcctaggtg ccgaccaacc cccaggatgg cggaagctca        60
     ccaggccgtg gccttccagt tcacggtgac cccagacggg gtcgacttcc ggctcagtcg       120
     ggaggccctg aaacacgtct acctgtctgg gatcaactcc tggaagaaac gcctgatccg       180
     catcaagaat ggcatcctca ggggcgtgta ccctggcagc cccaccagct ggctggtcgt       240
     catcatggca acagtgggtt cctccttctg caacgtggac atctccttgg ggctggtcag       300
     ttgcatccag agatgcctcc ctcaggggtg tggcccctac cagaccccgc agacccgggc       360
     acttctcagc atggccatct tctccacggg cgtctgggtg acgggcatct tcttcttccg       420
     ccaaaccctg aagctgcttc tctgctacca tgggtggatg tttgagatgc atggcaagac       480
     cagcaacttg accaggatct gggctatgtg tatccgcctt ctatccagcc ggcaccctat       540
     gctctacagc ttccagacat ctctgcccaa gcttcctgtg cccagggtgt cagccacaat       600
     tcagcggtac ctagagtctg tgcgcccctt gttggatgat gaggaatatt accgcatgga       660
     gttgctggcc aaagaattcc aggacaagac tgcccccagg ctgcagaaat acctggtgct       720
     caagtcatgg tgggcaagta actatgtgag tgactggtgg gaagagtaca tctaccttcg       780
     aggcaggagc cctctcatgg tgaacagcaa ctattatgtc atggaccttg tgctcatcaa       840
     gaatacagac gtgcaggcag cccgcctggg aaacatcatc cacgccatga tcatgtatcg       900
     ccgtaaactg gaccgtgaag aaatcaagcc tgtgatggca ctgggcatag tgcctatgtg       960
     ctcctaccag atggagagga tgttcaacac cactcggatc ccgggcaagg acacagatgt      1020
     gctacagcac ctctcagaca gccggcacgt ggctgtctac cacaagggac gcttcttcaa      1080
     gctgtggctc tatgagggcg cccgtctgct caagcctcag gatctggaga tgcagttcca      1140
     gaggatcctg gacgacccct ccccacctca gcctggggag gagaagctgg cagccctcac      1200
     tgcaggagga agggtggagt gggcgcaggc acgccaggcc ttctttagct ctggaaagaa      1260
     taaggctgcc ttggaggcca tcgagcgtgc cgctttcttc gtggccctgg atgaggaatc      1320
     ctactcctat gaccccgaag atgaggccag cctcagcctc tatggcaagg ccctgctaca      1380
     tggcaactgc tacaacaggt ggtttgacaa atccttcact ctcatttcct tcaagaatgg      1440
     ccagttgggt ctcaatgcag agcatgcgtg ggcagatgct cccatcattg ggcacctctg      1500
     ggagtttgtc ctgggcacag acagcttcca cctgggctac acggagaccg ggcactgcct      1560
     gggcaaaccg aaccctgcgc tcgcacctcc tacacggctg cagtgggaca ttccaaaaca      1620
     gtgccaggcg gtcatcaaga gttcctacca ggtggccaag gcgttggcag acgacgtgga      1680
     gttgtactgc ttccagttcc tgccctttgg caaaggcctc atcaagaagt gccggaccag      1740
     ccctgatgcc tttgtgcaga tcgcgctgca gctggctcac ttccgggaca ggggtaagtt      1800
     ctgcctgacc tatgaggcct caatgaccag aatgttccgg gagggacgga ctgagactgt      1860
     gcgttcctgt accagcgagt ccacagcctt tgtgcaggcc atgatggagg ggtcccacac      1920
     aaaagcagac ctgcgagatc tcttccagaa ggctgctaag aagcaccaga atatgtaccg      1980
     cctggccatg accggggcag ggatcgacag gcacctcttc tgcctttact tggtctccaa      2040
     gtacctagga gtcagctctc ctttccttgc tgaggtgctc tcggaaccct ggcgtctctc      2100
     caccagccag atcccccaat cccagatccg catgttcgac ccagagcagc accccaatca      2160
     cctgggcgct ggaggtggct ttggccctgt agcagatgat ggctatggag tttcctacat      2220
     gattgcaggc gagaacacga tcttcttcca catctccagc aagttctcaa gctcagagac      2280
     gaacgcccag cgctttggaa accacatccg caaagccctg ctggacattg ctgatctttt      2340
     ccaagttccc aaggcctaca gctgaagccc ttaggtacct gtgttttgtt tgggaactcg      2400
     gaggccctcc ccctccccca gctcagacca cagaggtggc aagagaaggg ctgaagctgg      2460
     aagactgttc atgagggact tgtgtgacct gctttgaaat gtgtgactct gctgagtgac      2520
     gtaggctctg agatagctgt ccacgcccac gtgtttgctt ggaataaata cttgcc          2576
//


spacer
spacer