spacer

EBI Dbfetch

ID   U59686; SV 1; linear; genomic DNA; STD; HUM; 255 BP.
XX
AC   U59686;
XX
DT   08-JUL-1996 (Rel. 48, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 11)
XX
DE   Human MHC class II antigen (HLA-DRB1) gene, DRB1*16012, exon 2 and partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-255
RX   DOI; 10.1034/j.1399-0039.1999.540411.x.
RX   PUBMED; 10551425.
RA   Lin Y.S., Tang T.F., Ng J., Hartzman R., Hurley C.K.;
RT   "Two DR2-associated novel alleles arose from the silent mutation of codon
RT   72: DRB1*16012, DRB5*01012";
RL   Tissue Antigens 54(4):405-408(1999).
XX
RN   [2]
RP   1-255
RA   Hurley C.K., Tang T.F., Lin Y.S.;
RT   ;
RL   Submitted (30-MAY-1996) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Resevoir Rd.NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; ea569739e1567676e31ab5717f8e2258.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
XX
CC   On Aug 15, 1996 this sequence version replaced gi:1399868.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..255
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /strain="GN00150"
FT                   /mol_type="genomic DNA"
FT                   /haplotype="DRB1*1301/16012; A3, A11; B7, B27; Bw4, Bw6;
FT                   DRB1*1301, 16012; DRB3*0202; DRB5*0202; DQA1*0102, 0103;
FT                   DQB1*0502, 0603"
FT                   /tissue_type="whole blood"
FT                   /note="Caucasian"
FT                   /db_xref="taxon:9606"
FT   exon            <1..>255
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>255
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="major histocompatibility class II antigen"
FT                   /note="DRB1*16012; HLA-DR"
FT                   /db_xref="GOA:Q29974"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*16:01:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29974"
FT                   /protein_id="AAB52230.1"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFT"
XX
SQ   Sequence 255 BP; 54 A; 61 C; 93 G; 47 T; 0 other;
     cgtttcctgt ggcagcctaa gagggagtgt catttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaggag gagtccgtgc gcttcgacag cgacgtgggg       120
     gagtaccggg cggtgacgga gctggggcgg cctgacgctg agtactggaa cagccagaag       180
     gacttcctgg aagacaggcg ggccgcggtg gacacctact gcagacacaa ctacggggtt       240
     ggtgagagct tcaca                                                        255
//


spacer
spacer