Dbfetch

ID   U52842; SV 1; linear; mRNA; STD; MUS; 2161 BP.
XX
AC   U52842;
XX
DT   07-MAY-1996 (Rel. 47, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus kidney-specific transport protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2161
RX   DOI; 10.1074/jbc.272.10.6471.
RX   PUBMED; 9045672.
RA   Lopez-Nieto C.E., You G., Bush K.T., Barros E.J., Beier D.R., Nigam S.K.;
RT   "Molecular cloning and characterization of NKT, a gene product related to
RT   the organic cation transporter family that is almost exclusively expressed
RT   in the kidney";
RL   J Biol Chem 272(10):6471-6478(1997).
XX
RN   [2]
RP   1-2161
RA   Lopez-Nieto C.E.;
RT   ;
RL   Submitted (27-MAR-1996) to the INSDC.
RL   Carlos E. Lopez-Nieto, Medicine, Brigham and Women's Hospital, 75 Francis
RL   Street, Boston, MA 02115, USA
XX
DR   MD5; 08d0da6e7a0eb52d39666cdb70efe54c.
DR   Ensembl-Gn; ENSMUSG00000024650; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024801; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024769; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024744; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024769; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024535; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025216; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024008; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024509; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024636; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024603; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024723; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024630; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025265; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023753; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024070; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000010250; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050949; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050933; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050888; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050880; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050622; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0051379; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050760; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0050561; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0050654; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050623; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050784; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050616; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051494; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050349; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049909; mus_musculus_wsbeij.
DR   EuropePMC; PMC4750486; 25475361.
DR   EuropePMC; PMC98904; 9529885.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2161
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /db_xref="taxon:10090"
FT   CDS             182..1819
FT                   /codon_start=1
FT                   /product="kidney-specific transport protein"
FT                   /note="organic cation transporter homolog; similar to
FT                   organic cation transporter OCT-1, encoded by GenBank
FT                   Accession Number X78855, and novel liver-specific
FT                   transporter NLT encoded by GenBank Accession Number L27651"
FT                   /db_xref="GOA:Q8VC69"
FT                   /db_xref="InterPro:IPR004749"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:892001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC69"
FT                   /protein_id="AAC53112.1"
FT                   /translation="MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIP
FT                   AHHCRPPANANLSKDGGLEARLPLDKQGRPESCLRFPFPHNGTEANGTGVTEPCLDGWV
FT                   YDNSTFPSTIVTEWNLVCSHRAFRQLAQSLFMVGVLLGAMMFGYLADRLGRRKVLILNY
FT                   LQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGY
FT                   VYSLGQFLLAGIAYAVPHWRHLQLAVSVPFFVAFIYSWFFIESARWYSSSGRLDLTLRA
FT                   LQRVARINGKQEEGAKLSIEVLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLW
FT                   FATSFAYYGLVMDLQGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLA
FT                   GICILVNGIIPRGHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTM
FT                   ARVGSIVSPLISMTAEFYPSIPLFIFGAVPVAASAVTALLPETLGQPLPDTVQDLKSRS
FT                   RGKQKQQQLEQQKQMIPLQVSTQEKNGL"
XX
SQ   Sequence 2161 BP; 478 A; 656 C; 560 G; 467 T; 0 other;
     ggaggggcag cccaccagcc cgctgtctcg ccacagaacc ggctcagctc caactccagg        60
     agtcactcag ctgcagaggc agtggcagcc ctactcctca ggcaaagggc agcagacaga       120
     cagacagagg tcctaggact ggaggtcctc aggcattgac cactcagcct ggcccagccc       180
     catggccttc aatgacctcc tgaaacaggt ggggggtgtc ggacgcttcc agctgattca       240
     ggtcaccatg gtggttgctc ccctactgct gatggcttcc cacaacaccc tgcagaactt       300
     cactgctgct atccccgctc accactgccg cccacctgct aatgccaacc tcagcaaaga       360
     tggaggtctg gaggcccggc tgcccctgga caagcaagga cgacccgaat cttgcctccg       420
     ctttcctttc ccgcacaatg gcacagaggc caatggcacc ggagtcacag agccctgcct       480
     tgatggctgg gtctatgaca acagcacctt cccttcaacc atcgtgactg agtggaacct       540
     tgtgtgctct catcgggcct tccgccagct ggcccagtcc ctgttcatgg tgggagtgtt       600
     actgggagcc atgatgtttg gctacctggc ggacaggctg ggccgtcgga aggtgctgat       660
     cttgaactac ctgcaaacag ctgtgtcggg aacctgtgca gcctatgcac ccaactatac       720
     tgtctactgc attttccggc tcctctcggg catgtctttg gctagcattg caatcaactg       780
     catgacacta aacatggagt ggatgcctat tcacacccgt gcctatgtgg gcaccttgat       840
     tggctatgtc tacagcttgg gccagttcct cctggctggt atcgcctatg ctgtgcccca       900
     ctggcgccac ctgcagcttg cggtctctgt gccttttttc gttgccttca tctactcttg       960
     gttcttcatt gagtcagccc gctggtactc ctcctctgga aggctggacc tcaccctccg      1020
     agccctgcag agagtggccc gcatcaacgg gaaacaagaa gagggggcta agctgagtat      1080
     agaggtgctc cagaccagcc tgcagaagga actgactcta aacaaaggcc aggcctccgc      1140
     catggagctg ctgcgctgcc ccacgcttcg gcgcctcttc ctctgcctct ctatgctgtg      1200
     gtttgccact agctttgcct actacgggct ggtcatggac ctgcagggct ttggggtcag      1260
     catgtacctt atccaggtga ttttcggcgc tgtggacctg cctgccaagt ttgtgtgctt      1320
     cctagtcatc aattccatgg gccgccggcc tgcacagttg gcctccctgc tgctggcagg      1380
     catctgtatc ctagtgaatg gcataatacc gaggggccat acaatcattc gcacatccct      1440
     ggctgtacta gggaaaggct gtctggcttc ctctttcaac tgcatcttcc tgtacaccgg      1500
     agagctgtac cccacaatga ttcggcagac gggcctgggc atgggcagca ccatggcccg      1560
     ggtgggcagc atagtgagcc cactgataag catgactgcc gagttctacc cctccatacc      1620
     tctcttcatc ttcggcgctg tccccgtggc cgccagcgct gtcactgccc tgctgccaga      1680
     gaccttgggc cagccgctgc ctgatacagt gcaggacctg aagagcagga gcagaggaaa      1740
     gcagaagcaa cagcagctgg aacagcagaa gcagatgata ccactccagg tctcaacaca      1800
     agagaagaac ggactctgaa aatggagagg gcgtcacaca gcactaaagg gagtggggtt      1860
     ctgcaggtcc caccatctat gaggaggggg agtgagtgga gggactgggc catctaaatg      1920
     cggagcctgc cattcagaga aatgcctccc caaaggtcac ttcaatagac ctactaggaa      1980
     caaaagctct aactgtgtgc agcttcttaa gcagaatgag ctcttcctca gccatcttcc      2040
     agctcagtgg tcactcctcc agctcctgtc ccttccacct ccaggacatt gcaagaatcc      2100
     cagacattaa ataaatttct tctacctcga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2160
     a                                                                      2161
//