spacer

EBI Dbfetch

ID   U51805; SV 1; linear; mRNA; STD; MUS; 1221 BP.
XX
AC   U51805;
XX
DT   04-MAY-1996 (Rel. 47, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus arginase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1221
RA   Chieko H.;
RT   ;
RL   Submitted (19-MAR-1996) to the INSDC.
RL   The Center for Adult Diseases, Laboratory of Tumor Biology, 3
RL   Nakamichi-1-chome, Osaka 537, Japan
XX
DR   MD5; 49e171d4b929527c3cc9aa343b525868.
DR   Ensembl-Gn; ENSMUSG00000019987; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020161; mus_musculus.
DR   EuropePMC; PMC2394268; 12865923.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1221
FT                   /organism="Mus musculus"
FT                   /strain="B6/CBAFIJ(C57BL/6xCBA)"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             142..1113
FT                   /codon_start=1
FT                   /product="arginase"
FT                   /db_xref="GOA:Q61176"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="MGI:MGI:88070"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61176"
FT                   /protein_id="AAA98611.1"
FT                   /translation="MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEY
FT                   DVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLA
FT                   VGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFS
FT                   WVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGR
FT                   KKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPT
FT                   LGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK"
XX
SQ   Sequence 1221 BP; 354 A; 299 C; 333 G; 235 T; 0 other;
     ctacaagggc aagaaataca agcccctaga cctgcgaccc aagaagacta gagccatgcg        60
     ccgccggctc accaagcacg aggaggagct ggacagcccg agcacatgca gcagcagcag       120
     ccgctggaac ccagagagag catgagctcc aagccaaagt ccttagagat tatcggagcg       180
     cctttctcaa aaggacagcc tcgaggaggg gtagagaaag gccctgcagc actgaggaaa       240
     gctggtctgc tggaaaaact taaagaaaca gagtatgacg tgagagacca cggggacctg       300
     gcctttgttg atgtccctaa tgacagctcc tttcaaattg tgaagaaccc acggtctgtg       360
     gggaaagcca atgaagagct ggctggtgtg gtggcagagg tccagaagaa tggaagagtc       420
     agtgtggtgc tgggtggaga ccacagtctg gcagttggaa gcatctctgg ccacgccagg       480
     gtccaccctg acctatgtgt catttgggtg gatgctcaca ctgacatcaa cactcccctg       540
     acaaccagct ctgggaatct gcatgggcaa cctgtgtcct ttctcctgaa ggaactgaaa       600
     ggaaagttcc cagatgtacc aggattctcc tgggtgactc cctgcatatc tgccaaagac       660
     atcgtgtaca ttggcttgcg agacgtagac cctggggaac actatataat aaaaactctg       720
     ggaattaagt atttctccat gactgaagta gacaagctgg ggattggcaa ggtgatggaa       780
     gagaccttca gctacctgct gggaaggaag aaaaggccga ttcacctgag ctttgatgtc       840
     gacgggctgg acccagcatt caccccggcg accggcaccc cggttctggg aggcctatct       900
     tacagagaag gtctctacat cacagaagaa atttacaaga cagggctcct ttcaggacta       960
     gatatcatgg aagtgaaccc aactcttggg aagacagcag aggaggtgaa gagtactgtg      1020
     aacacggcag tggctttaac cttggcttgc ttcggaactc aacgggaggg taaccataag      1080
     ccagggactg actaccttaa accacctaag tgactgtgaa tgcgccacat gaaaaccatc      1140
     tggggcatca cagcaaagca gacagaacta agcaaacgcc ttctcctccc aagggcttgt      1200
     tcttttaaaa aaaaaaaaaa a                                                1221
//


spacer
spacer