spacer

EBI Dbfetch

ID   U48420; SV 1; linear; mRNA; STD; MUS; 902 BP.
XX
AC   U48420;
XX
DT   16-MAR-1996 (Rel. 47, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus liver glutathione transferase theta class type 2 mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-902
RX   DOI; 10.1006/geno.1996.0165.
RX   PUBMED; 8617493.
RA   Whittington A.T., Webb G.C., Baker R.T., Board P.G.;
RT   "Characterization of a cDNA and gene encoding the mouse theta class
RT   glutathione transferase mGSTT2 and its localization to chromosome 10B5-C1";
RL   Genomics 33(1):105-111(1996).
XX
RN   [2]
RP   1-902
RA   Board P.G., Whittington A.T., Webb G.C., Baker R.T.;
RT   ;
RL   Submitted (06-FEB-1996) to the INSDC.
RL   Philip G.Board, John Curtin School of Medical Research, Australian National
RL   University, PO Box 334, Canberra, ACT 2601, Australia
XX
DR   MD5; a5fadeeac6dba00973f892b519a5f7ce.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
DR   EuropePMC; PMC23052; 10535984.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..902
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10B5-C1"
FT                   /strain="B6/CBA"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             132..866
FT                   /codon_start=1
FT                   /product="glutathione transferase theta class type 2"
FT                   /note="mGSTT2"
FT                   /db_xref="GOA:Q61133"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:106188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61133"
FT                   /protein_id="AAB03534.1"
FT                   /translation="MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQF
FT                   SQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHAD
FT                   NIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVT
FT                   LADLMSLEELMQPVGLGYNLFEGRPQLTAWRERVEAFLGAELYQEAHSTILSILGQAAK
FT                   KMLPVPPPEVHASMQLRIARIP"
XX
SQ   Sequence 902 BP; 206 A; 242 C; 257 G; 197 T; 0 other;
     cccaagatca gcaggtgtca gctatccaga ggaggaaatc gtttggcttg gccaactgag        60
     gctgtgctgg accccagctt gcttgctgtt atcgaacgca gtcggcacac catcttgtgt       120
     cgctaccggc aatgggcttg gagctctacc tggacctgct gtcacaaccc agccgcgctg       180
     tctacatctt cgccaagaag aatggcatcc ccttccagac gcgtaccgtg gatatactca       240
     aagggcagca catgagcgag caattctccc aggtgaactg cttaaacaaa gttcctgtac       300
     tcaaagacgg aagcttcgtg ttgaccgaaa gcacagccat cttgatttac ctgagttcca       360
     agtaccaggt ggcagaccac tggtacccgg ccgacctaca ggcccgtgcc caagtccacg       420
     aatacctggg ctggcatgcc gacaacatcc gtggtacttt cggagtgctc ctatggacca       480
     aggtgttggg gccactcatt ggggtccagg ttccccagga gaaggtggaa cggaacagag       540
     atagaatggt cctggttctg caacagctgg aggacaagtt cctcagggac agggccttcc       600
     ttgttggcca gcaggtgacg ctagcggatc tcatgtctct ggaggagttg atgcagcccg       660
     tgggccttgg ctataacctg tttgagggac ggcctcagct gacagcatgg cgagagaggg       720
     tggaggcgtt cttgggtgct gagctgtatc aggaggctca tagcaccatc ctgagcatcc       780
     tgggacaggc agccaagaaa atgttaccag taccccctcc ggaggtccat gccagcatgc       840
     agcttcgaat tgctaggatt ccttgagtgg tctgaccagc aataaagact cattttgtgt       900
     ta                                                                      902
//


spacer
spacer