spacer

EBI Dbfetch

ID   U48419; SV 1; linear; genomic DNA; STD; MUS; 3171 BP.
XX
AC   U48419;
XX
DT   25-MAR-1996 (Rel. 47, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus theta class glutathione transferase type 2 (mGSTT2) gene,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3171
RX   DOI; 10.1006/geno.1996.0165.
RX   PUBMED; 8617493.
RA   Whittington A.T., Webb G.C., Baker R.T., Board P.G.;
RT   "Characterization of a cDNA and gene encoding the mouse theta class
RT   glutathione transferase mGSTT2 and its localization to chromosome 10B5-C1";
RL   Genomics 33(1):105-111(1996).
XX
RN   [2]
RP   1-3171
RA   Board P.G., Whittington A.T.;
RT   ;
RL   Submitted (06-FEB-1996) to the INSDC.
RL   Philip G. Board, The John Curtin School of Medical Research, Australian
RL   National University, PO Box 334, Canberra, ACT 2601, Australia
XX
DR   MD5; a2b8ff6edf5c582977a8348af5ab6e2f.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3171
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10B5-C1"
FT                   /strain="129SV"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(470..580,1019..1105,1946..2095,2188..2361,2661..2870)
FT                   /codon_start=1
FT                   /product="theta class glutathione transferase type 2"
FT                   /db_xref="GOA:Q61133"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:106188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61133"
FT                   /protein_id="AAB03533.1"
FT                   /translation="MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKQHMSEQFS
FT                   QVNCLNKVPVLKDGSFVLTERTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHADN
FT                   IRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTL
FT                   ADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAKK
FT                   MLPVPPPEVHASMQLRIARIP"
XX
SQ   Sequence 3171 BP; 727 A; 832 C; 833 G; 779 T; 0 other;
     cagctggacc aaccacagtt cttccttaag gcaaagtttc tagcagcctg caacaagctt        60
     cacccgttaa agaaggatca gcgatcagcc tctaagatcc cctcctgcag taactgagag       120
     ctaggagctg agcgtctagt tccccgcaaa cgactacgtc cacagaactc tgagttgggt       180
     ccacgaaagc ccagctaggc catttccgcg tccgggtgag actaaggtcc tgggctggat       240
     tcctggctcc acggtccgct ggagcaaatc gcataagtca gtctgagtgc gcgcgcacct       300
     cagccctgct tttggtataa agtcctccaa agcgtctccc tccccaagat cagcaggtgt       360
     cagctatcca gaggaggaaa tcgtttggct tggccaactg aggctgtgct ggaccccagc       420
     ttgctgttat cgaacgcagt cggcacacca tcttgtgtcg ctaccggcaa tgggcttgga       480
     gctctacctg gacctgctgt cacaacccag ccgcgctgtc tacatcttcg ccaagaagaa       540
     tggcatcccc ttccagactc gtaccgtgga tatactcaaa ggttggcaca tttaccccta       600
     gaccatgtca gtccttcaca ttctgcctgg gtacaatctc cccatcatct gacccccccc       660
     acccccagcg ccgtccacca aggaatgctc tgctctcttt ggagtggtct tagtcagttc       720
     agagccctct ttaaacgtaa cttccgctct gacaagagag actttttgtc ctgggacgtg       780
     gggagaaaaa tgaaagattc ctacagtttc tgctttgaag gcacgcagtg tttagattca       840
     caaaattccg gagactttgc agggaagaga cacatagctg agccacctct gtgcctctgg       900
     ttcccggccc atccggattt tggccgtttc gaccttgctc tggttgcaaa gagaaagggg       960
     aaaataggaa tactgcttga gtccttgcac gcattttctg gcttcttcct tcccagggca      1020
     gcacatgagc gagcaattct cccaggtgaa ctgcttaaac aaagttcctg tactcaaaga      1080
     cggaagcttc gtgttgaccg aaaggtgcag ctgtaaatat acccagagcc ctcactacct      1140
     cctccggctc cctttggccg ccccacttcc gttggcgtgg ggtgcggggc ggggccctgg      1200
     ccgactccga ccctaggctg tgagggggcc tggctagagc agactctgtg ggaaggggtc      1260
     ctggaagact agagggctga tccagcatgt cccttgcttc tgtcctgttt catctgctgg      1320
     actccccccc tccccctcca ggcctcccta tcctgattga ggggtattgg aaggcgacaa      1380
     ggggacgatt gtcaagggtt agggaaaaaa aaatgtagat tcaacaaagg actaggaagg      1440
     gcttctccta acttcctaga tgtcctgttt aatccgccaa agcttggccc cggagaccaa      1500
     tgaaagggtc agggctcaca gactgtttgg ttctcccatt agagtctagt gtcagagagc      1560
     taaaaaacaa aacaaaacaa caacaaaaaa aaacccacaa aacaacaaca accaccacca      1620
     aaaaagaaag gcggagagaa aaaggtctgg ccaggggtca gtgtccacga catcaaaaaa      1680
     agaggcgacc tggagagggg cagagctctt gctggtgtct gtctgtgtgt gtctgtgtgt      1740
     gtctctgggt ttcaccatgc acaacattgc agagaagaaa ggctctgggg acaggcaaga      1800
     gtcatggaga gataggtggt gagaccagag ggaagtactt caaatgtgag aattctgaag      1860
     gccccgccaa gggatgggaa acagccaagg tccttaaatc ccctcttccc atggtccata      1920
     tagcccctct tctatgattc ccagcacagc catcttgatt tacctgagtt ccaagtacca      1980
     ggtggcagac cactggtacc cggccgacct acaggcccgt gcccaagtcc acgaatacct      2040
     gggctggcat gccgacaaca tccgtggtac tttcggagtg ctcctatgga ccaaggtatc      2100
     cagggtcctc tggggagggg ctgaaccttg ggcacccagt aagagtcagg cttatttata      2160
     gattgagctc gtctgtcgtt ctgccaggtg ttggggccac tcattggggt ccaggttccc      2220
     caggagaagg tggaacggaa cagagataga atggtcctgg ttctgcaaca gctggaggac      2280
     aagttcctca gggacagggc cttccttgtt ggccagcagg tgacgctagc ggatctcatg      2340
     tctctggagg agttgatgca ggtaggagac cagcagatgg ggtagtagta gctaagggcg      2400
     gactcttctt tttgctactt ccccaagtcc aaagcactgt ggtctgggaa aagccagaac      2460
     catagagggg aactttgtgt gatttgtttc ctgtctaggt gggaagtggg gagtggggtg      2520
     gggggcagct tctggcctgt gtcaggtcct ggatctgatc acagtgcccc agacctccca      2580
     tgggctgtgt ctatgatgct tgtgttgcct gcaatgggac cctcggtatc tcttcgactt      2640
     tcccatcttt gtctctacag cccgtggctc ttggctataa cctgtttgag ggacggcctc      2700
     agctgacagc atggcgagag agggtggagg cgttcttggg tgctgagctg tgtcaggagg      2760
     ctcatagcac catcctgagc atcctgggac aggcagccaa gaaaatgtta ccagtacccc      2820
     ctccggaggt ccatgccagc atgcagcttc gaattgctag gattccttga gtggtctgac      2880
     cagcaataaa gactcatttt gtgttttttc tttccttttt tttctttttt ttaaaaaata      2940
     tttatttatt tatttattat atgtaagtac actgtagctg tcttcgagct ctcattacgg      3000
     gtggttgtga gccacaatgt ggttgctggg atttgaactt cggacctttg gaagagcagt      3060
     cgggtgctct tacccactga gacatctcac caaccccttc ctttttttct taacgtttat      3120
     ttttgcccca gtcttttatc ctggctccct ctctgactct gagagaagct t               3171
//


spacer
spacer