spacer

EBI Dbfetch

ID   U47281; SV 1; linear; genomic DNA; STD; MUS; 1385 BP.
XX
AC   U47281;
XX
DT   06-APR-1996 (Rel. 47, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 4)
XX
DE   Mus musculus bradykinin B1 subtype receptor gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1385
RX   DOI; 10.1006/bbrc.1996.0384.
RX   PUBMED; 8602848.
RA   Pesquero J.B., Pesquero J.L., Oliveira S.M., Roscher A.A., Metzger R.,
RA   Ganten D., Bader M.;
RT   "Molecular cloning and functional characterization of a mouse bradykinin B1
RT   receptor gene";
RL   Biochem. Biophys. Res. Commun. 220(1):219-225(1996).
XX
RN   [2]
RP   1-1385
RA   Pesquero J.B., Pesquero J.L., Oliveira S.M., Roscher A.A., Metzger R.,
RA   Ganten D., Bader M.;
RT   ;
RL   Submitted (26-JAN-1996) to the INSDC.
RL   Michael Bader, Hypertension Research, Max-Delbruck-Center for Molecular
RL   Medicine (MDC), Wiltbergstr. 50, 134D, Berlin, D-13125, Germany
XX
DR   MD5; e146c3093d8bee912be7daf7eb9e39a4.
DR   Ensembl-Gn; ENSMUSG00000041347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182899; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1385
FT                   /organism="Mus musculus"
FT                   /strain="129SVJ"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             88..1092
FT                   /codon_start=1
FT                   /product="bradykinin receptor B1 subtype receptor"
FT                   /note="G-protein coupled receptor"
FT                   /db_xref="GOA:Q61125"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000496"
FT                   /db_xref="InterPro:IPR001186"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:88144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61125"
FT                   /protein_id="AAA99778.1"
FT                   /translation="MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVIT
FT                   VCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENV
FT                   GNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQV
FT                   TCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPL
FT                   AAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDF
FT                   LVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL"
XX
SQ   Sequence 1385 BP; 271 A; 396 C; 376 G; 342 T; 0 other;
     gtgtgtgcca ataaaacttt attgtctggg atagaccaca gctgggcttg gcctcctata        60
     ctctctgtca atttcaggtt cctgtggatg gcgtcccagg cctcgctgaa gctacagcct       120
     tctaaccaaa gccagcaggc ccctcccaac atcacctcct gcgagggcgc cccggaagcc       180
     tgggatctgc tgtgtcgggt gctgccaggg tttgtcatca ctgtctgttt ctttggcctc       240
     ctggggaacc ttttagtcct gtccttcttc cttttgcctt ggcgacgatg gtggcagcag       300
     cggcggcagc gcctaaccat agcagaaatc tacctggcta acttggcagc ttctgatctg       360
     gtgtttgtgc tgggcctgcc cttctgggca gagaacgttg ggaaccgttt caactggccc       420
     tttggaagtg acctctgccg ggtggtcagc ggggtcatca aggccaacct gttcatcagc       480
     atcttcctgg tggtggccat cagtcaggac cgctacaggt tgctggtata ccccatgacc       540
     agctggggga accggcggcg acggcaagcc caagtgacct gcctgctcat ctgggtagct       600
     gggggcctct tgagcacccc cacgttcctt ctgcgttccg tcaaagtcgt ccctgatctg       660
     aacatctctg cctgcatcct gcttttcccc cacgaagctt ggcactttgt aaggatggtg       720
     gagttgaacg ttttgggttt cctcctccca ttggctgcca tcctctactt caactttcac       780
     atcctggcct ccctgagagg acagaaggag gccagcagaa cccggtgtgg gggacccaag       840
     gacagcaaga caatggggct gatcctcaca ctggtagcct ccttcctggt ctgctgggcc       900
     ccttaccact tctttgcctt cctggatttc ctggtccagg tgagagtgat ccaggactgc       960
     ttctggaagg agctcacaga cctgggcctg cagctggcca acttctttgc ttttgtcaac      1020
     agctgcctga acccactgat ttatgtcttt gcaggccggc tctttaagac cagggttctg      1080
     ggaactttat aagtgatgca cctctttata aaatgccggt attgcccagt aggaaagaac      1140
     tcttccaact gtcctgctgg aattgaaaca gcattgagcc aagaagcctg gcttcttgac      1200
     caaccgtctc tgctatcata gggaccatct ggctgagcca cagcccacaa agatgccgga      1260
     ggacagagta atcggaggac agggtagccg gaggacaggg tagccgggac ctcgcagatg      1320
     cacttaataa ggatcgagtc gacgccctat agtgagtccg atcattgcag ggcgcgagct      1380
     ctaga                                                                  1385
//


spacer
spacer