spacer

EBI Dbfetch

ID   U46956; SV 2; linear; genomic DNA; STD; MUS; 1739 BP.
XX
AC   U46956;
XX
DT   27-FEB-1996 (Rel. 46, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 6)
XX
DE   Mus musculus src homology collagen protein 66 kDa isoform gene, partial
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1739
RA   Blaikie P., Yajnik V., Margolis B.;
RT   ;
RL   Submitted (24-JAN-1996) to the INSDC.
RL   Pamela Blaikie, Howard Hughes Medical Institute, University of Michigan
RL   Medical School, 1150 West Medical Center Drive, Ann Arbor, MI 48103-0650,
RL   USA
XX
RN   [2]
RC   Sequence updated by submitter
RP   1-1739
RA   Margolis B.;
RT   ;
RL   Submitted (29-MAY-2001) to the INSDC.
RL   Howard Hughes Medical Institute, University of Michigan Medical School,
RL   1150 West Medical Center Drive, Ann Arbor, MI 48103-0650, USA
XX
DR   MD5; 9f3bddcb21bb33bb2182cae75977205d.
DR   Ensembl-Gn; ENSMUSG00000042626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107417; mus_musculus.
XX
CC   On May 29, 2001 this sequence version replaced gi:1200455.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1739
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>1739
FT                   /product="src homology collagen protein 66 kDa isoform"
FT   CDS             1..>1739
FT                   /codon_start=1
FT                   /product="src homology collagen protein 66 kDa isoform"
FT                   /db_xref="GOA:P98083"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006019"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:98296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98083"
FT                   /protein_id="AAA91777.2"
FT                   /translation="MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPI
FT                   LPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGL
FT                   LPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYL
FT                   VRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGR
FT                   SNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDP
FT                   VNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEE
FT                   EEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGD
FT                   HEVRKQMLPPPPCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMK
FT                   PFEDALRVPPPPQSMSMAEQLQGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYV
FT                   LTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVD
FT                   RKV"
XX
SQ   Sequence 1739 BP; 373 A; 494 C; 521 G; 351 T; 0 other;
     atggatcttc taccccccaa gccgaagtac aacccacttc ggaatgagtc tctgtcatcg        60
     ctggaggagg gggcttcggg gtctacccct ccggaggagc taccttcccc atcagcttca       120
     tccctgggac ccattctgcc tcctctgccg ggggacgata gtccgactac cctgtgttcc       180
     ttctttcccc ggatgagcaa cctgaagctg gccaatcctg ctggggggcg cctggggcct       240
     aaaggggagc caggaaaggc tgctgaagat ggggaaggga gtgcaggggc agcccttcgg       300
     gactcaggcc tcttgcccct cctccaggac atgaacaagc tgagtggagg cggcgggcgc       360
     aggactcggg tagaaggggg ccagctgggg ggcgaggagt ggaccagaca cgggagcttt       420
     gtcaataagc ccacacgagg ctggctgcat cccaacgaca aagtcatggg acctggggtt       480
     tcctacttgg ttcggtacat gggctgtgtg gaggtcttac agtcaatgcg agcccttgac       540
     ttcaataccc ggactcaggt caccagggag gccatcagtt tggtgtgtga agctgtgcct       600
     ggtgccaaag gggcgacaag gaggagaaag ccttgtagcc gcccactcag ctccatcctg       660
     gggaggagta acctgaagtt tgctggaatg ccaatcactc tcactgtgtc taccagcagc       720
     cttaacctca tggcagccga ctgcaaacag atcattgcca accatcacat gcaatctatc       780
     tctttcgcgt ccggtgggga tccggacaca gctgagtatg ttgcctatgt tgccaaagac       840
     cctgtgaatc agagagcctg ccatatcctg gagtgtcctg aagggcttgc tcaggatgtc       900
     atcagcacca tcgggcaggc ctttgagttg cgcttcaaac agtatctcag gaatccaccg       960
     aagctggtca ccccccatga caggatggct ggctttgatg gctcagcttg ggatgaggag      1020
     gaagaagagc cccctgacca tcagtactac aatgactttc cagggaagga accccctctt      1080
     ggtggggtgg tagatatgag gcttcgggaa ggggctgctc gacccactct gcctagtgcc      1140
     cagatgtcca gccacttggg agctacactg cctatagggc agcatgctgc aggagaccat      1200
     gaagtccgta aacagatgtt gcctccgccg ccttgcccag gcagagaact cttcgatgac      1260
     ccctcctatg tcaacatcca gaatctagac aaggcccggc aggctggggg tggggctggg      1320
     cccccaaatc cttctcttaa tggcagtgca ccccgagacc tttttgacat gaagcccttt      1380
     gaagatgcac ttcgggtgcc acccccaccg cagtccatgt ccatggctga gcagctgcaa      1440
     ggggagccct ggttccacgg gaagctgagc cggagggagg ccgaggcgct gctgcagctc      1500
     aatggtgact tcttggtgcg agagagcacg accacgcctg gccagtatgt gctcactggc      1560
     ctgcagagtg ggcagcccaa gcacttgctg ctggtggacc ctgaaggtgt ggttcggaca      1620
     aaggatcacc gctttgagag tgtcagtcac ctgatcagct accacatgga caatcacttg      1680
     cccatcatct ctgcgggcag cgaactgtgc ctacagcaac ccgtggatcg gaaagtgga       1739
//


spacer
spacer