spacer

EBI Dbfetch

ID   U46923; SV 1; linear; mRNA; STD; MUS; 1376 BP.
XX
AC   U46923;
XX
DT   05-APR-1996 (Rel. 47, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Mus musculus G protein-coupled receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1376
RA   Bonner T.I., Matsuda L.A.;
RT   "A G protein-coupled receptor expressed in NG108-15 and AtT-20 cells";
RL   Unpublished.
XX
RN   [2]
RP   1-1376
RA   Bonner T.I., Matsuda L.A.;
RT   ;
RL   Submitted (23-JAN-1996) to the INSDC.
RL   Tom I. Bonner, Lab of Cell Biology, NIMH, Bldg 36, Rm 3A-17, MSC 4090,
RL   Bethesda, MD 20892-4090, USA
XX
DR   MD5; b5361012dcb0f15e0b334fb20c6516ce.
DR   Ensembl-Gn; ENSMUSG00000032641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046255; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066107; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116515; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165392; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1376
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /clone="NGA"
FT                   /cell_line="NG108-15 and AtT-20"
FT                   /db_xref="taxon:10090"
FT   CDS             94..1323
FT                   /codon_start=1
FT                   /product="G protein coupled receptor"
FT                   /note="G protein coupled receptor of the rhodopsin family,
FT                   ligand unknown; appears to be the mouse homolog of a human
FT                   brain cDNA, GenBank Accession Numbers H07970 and H07878"
FT                   /db_xref="GOA:Q61121"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:892973"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61121"
FT                   /protein_id="AAA93354.1"
FT                   /translation="MDNDQPPVVTATLLVPLQNGSCAEAAEALLPHGLMGLHEEHSWMS
FT                   NRTELQYELNPGEVATASIFFGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACA
FT                   DLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICIDRFYTIVY
FT                   PLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTAYTVIHF
FT                   LVGFVIPSILIILFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLLLNLVFLF
FT                   SWLPFHVAQLWHPHEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFC
FT                   MSSMKCYRSNAYTITTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWP
FT                   INSNPPNTFV"
XX
SQ   Sequence 1376 BP; 306 A; 400 C; 337 G; 333 T; 0 other;
     tggctcatgg catcctccaa agtcctgtct gcgagttgtt cctgaccaag aaaacccgcg        60
     gagcctgact ctgaaatcca gtcccgatga agaatggata acgaccagcc gcctgtggtg       120
     actgccaccc tgctggtgcc ccttcagaac ggcagctgcg cggaagcagc tgaggccctg       180
     ctgccccatg gcctgatggg attgcatgag gagcacagct ggatgagcaa caggacagag       240
     cttcagtacg agctgaaccc tggagaggtg gccaccgcca gcatcttctt tggcgctttg       300
     tggttgttct ccatctttgg caattccctg gtatgtctgg tcatccaccg gagccggagg       360
     actcagtcca ccaccaacta cttcgtggtg tccatggcgt gtgctgacct tctcatcagc       420
     gtggccagca cgccgtttgt cgtgctgcag ttcaccaccg ggaggtggac cctgggtagc       480
     gccatgtgca aggtggtccg ctacttccag tacctcaccc ccggcgtgca gatctacgtg       540
     ctgctctcca tctgcatcga ccgcttctat accatcgtct acccgctgag cttcaaggtg       600
     tcccgagaga aggccaagaa aatgattgca gcctcctgga tcttggacgc ggccttcgtg       660
     acgcctgtct tctttttcta cggctctaac tgggatagtc actgtaacta cttcctccct       720
     ccctcctggg agggaactgc ctataccgtc atccacttct tggtgggctt cgtgattccc       780
     tccatcctca taatcctgtt ttaccagaag gtcataaagt atatctggag aataggcacg       840
     gacgggcgga cgctgagaag gacgatgaac attgtcccca ggacaaaggt gaaaacggtc       900
     aagatgttcc tgctcttgaa cctagtgttc ctgttctcct ggctaccttt ccatgtggct       960
     cagctctggc atccccatga gcaagactac aagaagagct cccttgtctt cacggcagtc      1020
     acgtgggtat ctttcagctc ttcagcctcg aaacccactc tgtactctat ttataatgcc      1080
     aattttcgga gagggatgaa agagacattc tgcatgtcct cgatgaaatg ctaccgcagc      1140
     aatgcctaca ccatcacgac cagctcgcgg atggccaaaa gaaactatgt gggcatttcg      1200
     gaaatccctc ccgtgagcag gaccataacc aaagactcca tctatgactc atttgaccgg      1260
     gaggccaggg agaagaagct cgcctggccc atcaactcaa accctccaaa cacttttgtc      1320
     tgatttctaa gaagtctttc actgttatgt gccagagatt aaaaagcttt cactat          1376
//


spacer
spacer