Dbfetch

ID   AH005859; SV 2; linear; genomic DNA; STD; HUM; 7318 BP.
XX
AC   AH005859; U46896-U46901;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 4 NACP/alpha-synuclein (NACP) gene, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7318
RA   Xia Y., Silva R.D., Chen X.H., Saitoh T.;
RT   ;
RL   Submitted (22-JAN-1996) to the INSDC.
RL   Tsunao Saitoh, Neurosciences, UCSD, 9500. Gilman Dr, La Jolla, CA
RL   92093-0624, USA
XX
RN   [2]
RC   Sequence update by submitter
RP   1-7318
RA   Xia Y., Silva R.D., Chen X.H., Saitoh T.;
RT   ;
RL   Submitted (13-JAN-1998) to the INSDC.
RL   Tsunao Saitoh, Neurosciences, UCSD, 9500. Gilman Dr, La Jolla, CA
RL   92093-0624, USA
XX
DR   MD5; 10c354189b6ffdf837fef51c9a342a48.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:2769657, gi:1230569, gi:1230570, gi:1230571, gi:1230572,
CC   gi:1230573, gi:2769658.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7318
FT                   /organism="Homo sapiens"
FT                   /chromosome="4"
FT                   /map="4q21.3-q22"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..7251
FT                   /gene="NACP"
FT   misc_feature    1..2700
FT                   /gene="NACP"
FT                   /note="5' flanking region"
FT   mRNA            join(2701..3078,3524..3669,4456..4497,5006..5148,
FT                   5632..5715,6143..7251)
FT                   /gene="NACP"
FT                   /note="isoform B; transcription start site (2701) was
FT                   identified by 5'-RACE"
FT   mRNA            join(2701..2859,3524..3669,4456..4497,5006..5148,
FT                   5632..5715,6143..7251)
FT                   /gene="NACP"
FT                   /note="isoform A; The 6 bp sequence in 5'-terminal of cDNA
FT                   isoform A does not match with genomic sequence;
FT                   transcription start site (2701) was identified by 5'-RACE"
FT   exon            2701..3078
FT                   /gene="NACP"
FT                   /note="1'"
FT   exon            2701..2859
FT                   /gene="NACP"
FT                   /number=1
FT   intron          2860..3016
FT                   /gene="NACP"
FT                   /number=1
FT   intron          3079..>3319
FT                   /gene="NACP"
FT                   /number=1
FT   gap             3320..3419
FT                   /estimated_length=unknown
FT   intron          <3420..3523
FT                   /gene="NACP"
FT                   /number=1
FT   exon            3524..3669
FT                   /gene="NACP"
FT                   /number=2
FT   CDS             join(3549..3669,4456..4497,5006..5148,5632..5715,
FT                   6143..6175)
FT                   /codon_start=1
FT                   /gene="NACP"
FT                   /product="NACP/alpha-synuclein"
FT                   /protein_id="AAC02114.1"
FT                   /translation="MDVFMXGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAXTGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
FT   intron          3670..>3955
FT                   /gene="NACP"
FT                   /number=2
FT   gap             3956..4055
FT                   /estimated_length=unknown
FT   intron          <4056..4455
FT                   /gene="NACP"
FT                   /number=2
FT   exon            4456..4497
FT                   /gene="NACP"
FT                   /number=3
FT   intron          4498..>4705
FT                   /gene="NACP"
FT                   /number=3
FT   gap             4706..4805
FT                   /estimated_length=unknown
FT   intron          <4806..5005
FT                   /gene="NACP"
FT                   /number=3
FT   exon            5006..5148
FT                   /gene="NACP"
FT                   /number=4
FT   intron          5149..>5308
FT                   /gene="NACP"
FT                   /number=4
FT   gap             5309..5408
FT                   /estimated_length=unknown
FT   intron          <5409..5631
FT                   /gene="NACP"
FT                   /number=4
FT   exon            5632..5715
FT                   /gene="NACP"
FT                   /number=5
FT   intron          5716..>6021
FT                   /gene="NACP"
FT                   /number=5
FT   gap             6022..6121
FT                   /estimated_length=unknown
FT   intron          <6122..6142
FT                   /gene="NACP"
FT                   /number=5
FT   exon            6143..7251
FT                   /gene="NACP"
FT                   /number=6
FT   intron          7252..>7318
FT                   /number=6
XX
SQ   Sequence 7318 BP; 1983 A; 1247 C; 1535 G; 2037 T; 516 other;
     gagctcagtt tctctgtcta taaaagttac ataaaatgta attcgatctg cttgttatga        60
     ctaaataaca tagtacatta gtcctttgcc aaaggactaa caaattacca aataaaagtt       120
     tggcatcatg ttaaacgttt ataagaagtg caactgtcca gaaataattc tctcacattg       180
     gtctgttgta atggagacct aaaatatctc attttattta cctctttgca cttaaagcac       240
     taggtctcaa gggagggtca tggttatact ataaatatgt catgtgaaat aatatattaa       300
     ataattgttg taatactcta ttgagatact agttgtaaag aggcacaatg gaaaacttat       360
     actattaaca gtagtaaaaa gaaacaacaa aaagcaataa aaaacaaaac acccattcat       420
     gcaacgacat gaacgaacct cacaaatatt atactgagta aaagaagtca gacaaatata       480
     aaacaagttt atactacgtg attagatctt tatgacattc tagatatgca catgaaggta       540
     caaggtaact gtctggaatg atgaaaatgt cctgtgtctt caaaatagtg tgggttacac       600
     taatgcatgg ctttttcaaa actgatttaa agggacacaa catctgagca tttccctagg       660
     tgtaaattac actgcaattt taaagaatca tctaatgata ttgtggttat ttttaaacag       720
     tccttaaatt ttgtggatgc atactgaatg tttacagctg aaagatatat ataaagcttg       780
     aatttggtaa aaaaaaaaaa aaaagaggga ggattggtag tgataaagtg agtggattta       840
     tggatgagac atgatcagcc atgcattgaa aaaatgtaaa agttggatga tcttcacatg       900
     agagtccttt attctgtcta cttttgcata tgtttcgaat atttcccata acaaaaagtt       960
     gaaaatagag tgatcacatg agttaatctc ctaatttaca aaaaagaaaa ctggaaacag      1020
     aaggagaaca aaacttgttc aaggtctcaa agccagacag caaactagct cccaagtcca      1080
     accttcttgc tctggtccta agcaaacaaa aaatattaat atgagctact gcattaagga      1140
     aagtctgctt ttccaaaggg cagaccaata gttcaaggaa gagtttaaat aataaatatt      1200
     tgtgatctta ctttcatgct tttctatttt ccactgaaca catatgcatt atcttctata      1260
     tgtcttttat gtataatcat ttgcttcctg ttccttgtgg ttttaaagtt gttttgtatg      1320
     tttaaatttg attttactca aatttcagaa cccaaattac gcgaagaatc agacaaagca      1380
     taactttcta taaatataaa aacaattaaa aaaaaaacat acagcaaaaa cgagttgttg      1440
     tttcccccct cctcttccag tgcttaacta atcttccgaa tccaggcaca gaaagcaaag      1500
     gctttctgct agtgggagga gcttgcttct ccattctggt gtgatccaga acagctgtct      1560
     tccagctctg aaagaggtga aaatgtgtta agcgatgcaa aaattgtctt gaagttcgcg      1620
     tgtgtatgtc tgtgtgcatg tgcgtgtggt gggtgggggg agagaaaagg gggtgtcaat      1680
     tctgagggca acgagaatca gaagtcagaa aggtgagtgg tgtgtagcat ctccctttca      1740
     gaaggggctg aagaagaaat tggatatgat ggtccggtag gctaaatcac gctggatttg      1800
     tctcccagat aaaggaggtc tgcaaagtaa gtcccatttc tagagcgaaa agccttagga      1860
     ccgcttgttt tagacggctg gggaatattt attccttgtt ccactgatgg gaaaatcagc      1920
     gtctggcagg cgctgattgg tggaaaggaa aatggtgata gtggcgtgga aagaggattt      1980
     gctgagcctt ctcctgcctc ctcaacctgt gactcttcct tagtagtctc cctttcaccc      2040
     tcagaaccct ttccggctct tcctagatta agagaaacga aaaccttgaa gaatatttga      2100
     actaaagcga cccctaacgt tgtaacctgt gaccgtgatt aaatttcagc gatgcgaggg      2160
     caaagcgctc tcggcggtgc ggtgtgagcc acctcccgcg ctgcctgtct cctccagcag      2220
     ctccccaagg gatagctctg cccttggtgg tcgaccctca ggccctcggt ctcccagggc      2280
     gactctgacg aggggtaggg ggtggtcccc gggaggaccc agaggaaagg cggggacaag      2340
     aagggagggg aaggggaaag aggaagaggc atcatcccta gcccaaccgc tcccgatctc      2400
     cacaagagtg ctcgtgaccc taaacttaac gtgaggcgca aaagcgcccc aaccttttcc      2460
     cgccttgggc caggcaggcg gctggagttg atggctcacc ccgcgccccc tgccccatcc      2520
     ccatccgaga tagggacgag gagcacgctg cagggaaagc agcgagcgcc gggagagggg      2580
     cgggcagaag cgctgacaaa tcagcggtgg gggcggagag ccgaggagaa ggagaaggag      2640
     gaggactagg aggaggagga cggcgacgac cagaaggggc ccaagagagg gggcgagcga      2700
     ccgagcgccg acgcggaagt gaggtgcgtg cgggctgcag cgcagacccc ggcccggccc      2760
     ctccgagagc gtcctgggcg ctccctcacg ccttgccttc aagccttctg cctttccacc      2820
     ctcgtgagcg gagaactggg agtggccatt cgacgacagg ttagcgggtt tgcctcccac      2880
     tcccccagcc tcgcgtcgcc ggctcacagc ggcctcctct ggggacagtc ccccccgggt      2940
     gccgcctccg cccttcctgt gcgctccttt tccttcttct ttcctattaa atattatttg      3000
     ggaattgttt aaattttttt tttaaaaaaa gagagaggcg gggaggagtc ggagttgtgg      3060
     agaagcagag ggactcaggt aagtacctgt ggatctaaac gggcgtcttt gaaatcctga      3120
     gaacgccgga tgggagacga atggtcgtgg gcaccgggag ggggtggtgc tgccatgagg      3180
     accgctgggc caggtctctg ggaggtgagt acttgtcctt tggggagcct aaggaaagag      3240
     acttgacctg gctttcgtcc tgcttctgat attcccttct ccacaagggc tgagaggtta      3300
     ggctgcttct ccgggatccn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnc      3420
     ttaaaagagt ctcacacttt ggagggtttc tcatgatttt tcagtgtttt ttgtttattt      3480
     ttccccgaaa gttctcattc aaagtgtatt ttatgttttc cagtgtggtg taaagaaatt      3540
     cattagccat ggatgtattc atgnaaggac tttcaaaggc caaggaggga gttgtggctg      3600
     ctgctgagaa aaccaaacag ggtgtggcag aagcagcagg aaagacaaaa gagggtgttc      3660
     tctatgtagg taggtaaacc ccaaatgtca gtttggtgct tgttcatgag tgatgggtta      3720
     ggataacaat actctaaatg ctggtagttc tctctcttga ttcatttttg catcattgct      3780
     tgtcaaaaag gtggactgag tcagaggtat gtgtaggtag gtgaatgtga acgtgtgtat      3840
     ntgagctaat agtaaaaatg cgactgtttg cttttcagat ttttaatttt gcctaatatn      3900
     tatgacttnt taaaatgaat gtttctgtac tacataattc tatntcagag acagtnnnnn      3960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnctgca ggtcaacgga tctgtctcta      4080
     gtgctgtact tttaaagctt ctacagttct gaattcaaaa ttatcttctc actgggcccc      4140
     ggtgttatct cattcttttt tctcctctgt aagttgacat gtgatgtggg aacaaagggg      4200
     ataaagtcat tattttgtgc taaaatcgta attggagagg acctcctgtt agctgggctt      4260
     tcttctatnt attgtggtgg ttaggagttc cttcttctag ttttaggata tatatatata      4320
     tttttttctt tccctgaaga tataataata tatatacttc tgaagattga gatttttaaa      4380
     ttagttgtat tgaaaactag ctaatcagca atttaaggct agcttgagac ttatgtcttg      4440
     aatttgtttt tgtaggctcc aaaaccaagg agggagtggt gcatggtgtg gcaacaggta      4500
     agctccattg tgcttatatc aaagatgata tntaaagtat ctagtgatta gtgtggccca      4560
     gtatcaagat tcctatgaaa ttgtaaaaca atcactgagc atctaagaac atatcagtct      4620
     tattgaaact gaattcttta taaagtattt ttaaataggt aaatattgat tataaataaa      4680
     aaatatactt gccaagaata atgagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4800
     nnnnnatatc ttagccaaga ttcaatgttt ggttgaacca cactcacttg acatcttggt      4860
     ggcttttgtt tcttctgacc actcagttat ctatggcatg tgtagataca ggtgtatgga      4920
     ancgatggct agtggaagtg gaatgatttt aagtcactgt tattctacca ccctttaatc      4980
     tgttgttgct ctttatttgt accagtggct gagaagacca aagagcaagt gacaaatgtt      5040
     ggaggagcag tggtgacggg tgtgacagca gtagcccaga agacagtgga gggagcaggg      5100
     agcattgcag canccactgg ctttgtcaaa aaggaccagt tgggnaaggt atggctgtgt      5160
     acgttttgtg ttacatttat aagctggtga gattacggtt cattttcatg tgaanctgga      5220
     ggcaggagca agatacttac tgtggggaac ggctacctga ccctcccctt gtgaaaaagt      5280
     gctaccttta tattggtctt gcttgtttnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5340
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5400
     nnnnnnnnaa aagtttacat actttgaggt tgataaccca tgttgccgca atgtttcccc      5460
     ggaggcattg tggagtttag aatgccagta gtaatattaa ggtgtgccat tttcaagatc      5520
     cgtggccaac atccctatat gtaagatttt tccaaaacat ggttctgatt tttaaaagtg      5580
     aaaaatgcta cttcatcatg ttctttttgt gcttcttact ttaaatatta gaatgaagaa      5640
     ggagccccac aggaaggaat tctggaagat atgcctgtgg atcctgacaa tgaggcttat      5700
     gaaatgcctt ctgaggtagg agtccaagct gaatctttct aacaagacag taccaaaaac      5760
     ctgtcattgt cacatttctc tttcattagt gcttagtgag aatcatttgc tctctacatg      5820
     ctcattacgt ggacaacttg caagttaaga atagttttta catttttaaa gggtccttaa      5880
     aaaaaaagag gaggaggaag atgaagaaga ggaagaaagg atgtaaaaga aatcatatgt      5940
     agtccacata gcttaatata cntactactt gaccctttac aggaaaagct ttactaaccc      6000
     ctgcattaga gaatatattt tnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6060
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6120
     nttttgattt ttctaatatt aggaagggta tcaagactac gaacctgaag cctaagaaat      6180
     atctttgctc ccagtttctt gagatctgct gacagatgtt ccatcctgta caagtgctca      6240
     gttccaatgt gcccagtcat gacatttctc aaagttttta cagtgtatct cgaagtcttc      6300
     catcagcagt gattgaagca tctgtacctg cccccactca gcatttcggt gcttcccttt      6360
     cactgaagtg aatacatggt agcagggtct ttgtgtgctg tggattttgt ggcttcaatc      6420
     tacgatgtta aaacaaatta aaaacaccta agtgactacc acttatttct aaatcctcac      6480
     tatttttttg ttgctgttgt tcagaagttg ttagtgattt gctatcatat attatnagat      6540
     ttttaggtgt cttttaatga tactgtctaa gaataatgac gtattgtgaa atttgttaat      6600
     atatatnata cttaaaaata tgtgagcatg aaactatgca cctataatac taaatatgaa      6660
     attttaccat tttgcgatgt gttttattca cttgtgtttg tatatnaatg gtgagaatta      6720
     aaataaaacg ttatctcatt gcaaaaatat tttattttta tcccatctca ctttaataat      6780
     aaaaatcatg cttataagca acatgaatta agaactgaca caaaggacaa aaatataaag      6840
     ttattaatag ccatttgaag aaggaggaat tttagaagag gtagagaaaa tggaacatta      6900
     accctacact cggaattccc tgaagcaaca ctgccagaag tgtgttttgg tatgcactgg      6960
     ttccttaagt ggctgtgatt aattattgaa agtggggtgt tgaagacccc aactactatt      7020
     gtagagtggt ctatttctcc cttcaatcct gtcaatgttt gctttacgta ttttggggaa      7080
     ctgttgtttg atgtgtatgt gtttataatt gttatacatt tttaattgag ccttttatta      7140
     acatatattg ttatttttgt ctcgaaataa ttttttagtt aaaatctatt ttgtctgata      7200
     ttggtgtgaa tgctgtacct ttctgacaat aaataatatn cgaccatgaa taaaaaaaaa      7260
     aaaaaagtgg gttcccggga actaagcagt gtagaagatg attttgacta caccctcc        7318
//