spacer

EBI Dbfetch

ID   U44436; SV 1; linear; genomic DNA; STD; MUS; 1164 BP.
XX
AC   U44436;
XX
DT   06-JAN-1999 (Rel. 58, Created)
DT   29-MAR-1999 (Rel. 59, Last updated, Version 2)
XX
DE   Mus musculus bradykinin B1 receptor gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1164
RA   Yanagawa T., Prado G.N., Paquet J.L., Bestian S., Cousins B., Navarro J.;
RT   "Novel pharmacological selectivity of the cloned murine B1 bradykinin
RT   receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-1164
RA   Yanagawa T.;
RT   ;
RL   Submitted (03-JAN-1996) to the INSDC.
RL   Toshihiko Yanagawa, Department of Physiology & Biophysics, Sealy Center for
RL   Molecular Science, University of Texas Medical Branch, 301 University Blvd.
RL   Rt. F-41, Galveston, TX 77554, USA
XX
DR   MD5; ac0fdf8cbd718e3b4e81fff0bef49914.
DR   Ensembl-Gn; ENSMUSG00000041347; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182899; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1164
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             7..1083
FT                   /codon_start=1
FT                   /product="bradykinin B1 receptor"
FT                   /note="G-protein coupled receptor"
FT                   /db_xref="GOA:Q61125"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000496"
FT                   /db_xref="InterPro:IPR001186"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:88144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61125"
FT                   /protein_id="AAD00029.1"
FT                   /translation="MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVIT
FT                   VCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENV
FT                   GNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQV
FT                   TCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVVGFLLPL
FT                   AAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLIPTLSSLFLVCWAPYHFFAFLDF
FT                   LVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVWELYKRCTSL
FT                   KNAVLPSRKELFQLSCWN"
XX
SQ   Sequence 1164 BP; 219 A; 343 C; 311 G; 291 T; 0 other;
     ctgtggatgg cgtcccaggc ctcgctgaag ctacagcctt ctaaccaaag ccagcaggcc        60
     cctcccaaca tcacctcctg cgagggcgcc ccggaagcct gggatctgct gtgtcgggtg       120
     ctgccagggt tcgtcatcac tgtctgtttc tttggcctcc tggggaacct tttagtcctg       180
     tccttcttcc ttttgccttg gcgacgatgg tggcagcagc ggcggcagcg cctaaccata       240
     gcagaaatct acctggctaa cttggcagct tctgatctgg tgtttgtgct gggcctgccc       300
     ttctgggcag agaacgttgg gaaccgtttc aactggccct ttggaagtga cctctgccgg       360
     gtggtcagcg gggtcatcaa ggccaacctg ttcatcagca tcttcctggt ggtggccatc       420
     agtcaggacc gctacaggtt gctggtatac cccatgacca gctgggggaa ccggcggcga       480
     cggcaagccc aagtgacctg cctgctcatc tgggtagctg ggggcctctt gagcaccccc       540
     acgttccttc tgcgttccgt caaagtcgtc cctgatctga acatctctgc ctgcatcctg       600
     cttttccccc acgaagcttg gcactttgta aggatggtgg agttgaacgt tgtgggtttc       660
     ctcctcccat tggctgccat cctctacttc aactttcaca tcctggcctc cctgagagga       720
     cagaaggagg ccagcagaac ccggtgtggg ggacccaagg acagcaagac aatggggctg       780
     atccccacac taagtagcct cttcctggtc tgctgggccc cttaccactt ctttgccttc       840
     ctggatttcc tggtccaggt gagagtgatc caggactgct tctggaagga gctcacagac       900
     ctgggcctgc agctggccaa cttctttgct tttgtcaaca gctgcctgaa cccactgatt       960
     tatgtctttg caggccggct ctttaagacc agggtctggg aactttataa gagatgcacc      1020
     tctttaaaaa atgcggtatt gcccagtagg aaagaactct tccaactgtc ctgctggaat      1080
     tgaaacagca ttgagccaag aagcctggct tcttgaccaa ccgtctctgc tatcataggg      1140
     accatctggt tggcttgagc caca                                             1164
//


spacer
spacer