Dbfetch

ID   U43321; SV 1; linear; genomic DNA; STD; MUS; 2421 BP.
XX
AC   U43321;
XX
DT   13-JAN-1996 (Rel. 46, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Mus musculus putative transmembrane receptor (frizzled 8) gene, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2421
RX   DOI; 10.1074/jbc.271.8.4266.
RX   PUBMED; 8626800.
RA   Wang Y., Macke J.P., Abella B.S., Andreasson K., Worley P., Gilbert D.J.,
RA   Copeland N.G., Jenkins N.A., Nathans J.;
RT   "A large family of putative transmembrane receptors homologous to the
RT   product of the Drosophila tissue polarity gene frizzled";
RL   J Biol Chem 271(8):4468-4476(1996).
XX
RN   [2]
RP   1-2421
RA   Abella B., Wang Y., Macke J.P., Nathans J.;
RT   ;
RL   Submitted (14-DEC-1995) to the INSDC.
RL   Jeremy Nathans, Molecular Biology and Genetics, Johns Hopkins Medical
RL   School, 725 N. Wolfe Street, Baltimore, MD 21205
XX
DR   MD5; b3d889bf30ad9beab5e0e5b4a6839ad9.
DR   Ensembl-Gn; ENSMUSG00000036904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041080; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2421
FT                   /organism="Mus musculus"
FT                   /chromosome="18"
FT                   /map="between Tpl2 and Cdh2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             188..2245
FT                   /codon_start=1
FT                   /gene="frizzled 8"
FT                   /product="transmembrane receptor"
FT                   /note="putative transmembrane receptor"
FT                   /db_xref="GOA:Q61091"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="MGI:MGI:108460"
FT                   /db_xref="PDB:1IJY"
FT                   /db_xref="PDB:4F0A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61091"
FT                   /protein_id="AAC52433.1"
FT                   /translation="MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKG
FT                   IGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPL
FT                   PPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSP
FT                   PRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGA
FT                   APCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLW
FT                   SVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGG
FT                   APGAGGRGGAGGAAAAGAGAAGRGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFL
FT                   LVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALS
FT                   SVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGG
FT                   PTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQA
FT                   RRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSG
FT                   PGGSGPGPGGGGGHGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV"
XX
SQ   Sequence 2421 BP; 403 A; 772 C; 779 G; 467 T; 0 other;
     gggggagggc cggacgactc cagcctaggt ttccaaccct gctgcctgaa aaggagatag        60
     actgttgcta ttctcctctg cagagaaaag tgggacacga cccgctctcc cttttctcag       120
     attcctcact gcagagccct cctgcgcgcc gcctagagaa ggaggacttg gggtcccagc       180
     gcgcagcatg gagtggggtt acctgttgga agtgacctcg ctcctagccg ccttggcggt       240
     gctacagcgc tctagcggcg ctgccgcggc ttcggccaag gagctggcgt gccaagagat       300
     cacggtgccg ttgtgcaaag gcatcggtta caactacact tacatgccca accagttcaa       360
     ccacgacacg caagatgagg cgggcctaga ggtgcaccag ttttggccgc tggtggagat       420
     acagtgctcc ccggacctca agttctttct gtgtagcatg tacacgccca tctgcctgga       480
     ggactacaag aagcctctgc cgccttgtcg ctctgtgtgt gaacgcgcca aggccggctg       540
     cgcgccgctc atgcgccagt acggctttgc ttggcctgac cgcatgcgct gcgatcggtt       600
     gccggagcag ggcaacccgg acactctgtg catggactac aaccgcaccg acctcaccac       660
     ggccgcgccc agcccaccgc gccgcctgcc tccgccgcct cctcccggcg agcagccgcc       720
     ctctggcagc ggccacagcc gcccgccagg ggccaggccc ccacatcgtg gcggcagcag       780
     taggggcagc ggggacgcgg cggctgcgcc cccttcgcgc ggcgggaagg cgaggccccc       840
     tggtggcggc gctgctccct gcgagccggg gtgccagtgc cgcgcgccca tggtgagcgt       900
     gtccagcgaa cgccacccgc tctacaaccg cgtcaagacc ggccagatcg ccaactgtgc       960
     gctgccctgc cacaacccct tctttagcca ggatgagcgc gccttcaccg tcttctggat      1020
     cggcctgtgg tcggtgctct gcttcgtctc caccttcgcc actgtctcta ccttcctcat      1080
     cgatatggag cgctttaagt acccggaacg gcccatcata ttcctctccg cctgttacct      1140
     cttcgtgtct gtcgggtacc tggtgcgcct ggtggcagga catgagaaag tggcctgcag      1200
     cggcggcgct ccgggtgctg gcggacgtgg gggtgcgggc ggcgcggcgg cggctggcgc      1260
     aggggcagcg ggacgggggg cgagcagccc gggcgcgcgc ggcgagtacg aggagctggg      1320
     cgcagttgag cagcatgttc gctatgagac cactggcccc gcgctgtgca cggtggtctt      1380
     tctccttgtc tacttttttg gcatggccag ctccatctgg tgggtaatcc tgtcgctcac      1440
     gtggttcttg gcagctggca tgaagtgggg taacgaggcc atagcaggct actcgcagta      1500
     cttccacctg gccgcgtggc ttgtgcccag cgtcaagtcc atcgcggtgc tggcgctcag      1560
     ctccgtagac ggcgacccgg tggcgggcat ctgctacgtg ggcaaccaga gccttgacaa      1620
     cctacgcggc tttgtgctgg cgccactggt tatctacctc ttcattggga ctatgtttct      1680
     gttagctggc ttcgtgtcgc tgttccgaat ccgttcagtc atcaagcagc aaggaggtcc      1740
     aactaagaca cacaagctag aaaaactcat gatccgcttg ggcctcttca ccgtgctcta      1800
     cacggtgccc gctgccgtcg ttgtcgcctg ccttttctat gagcagcaca accgaccgcg      1860
     ctgggaggcc acgcacaact gcccatgcct tcgggacctg caaccggacc aggctcgcag      1920
     gcccgattac gcggtcttca tgctcaagta cttcatgtgc ctagtagtgg gcatcacatc      1980
     gggcgtgtgg gtctggtccg gcaagactct ggagtcctgg cgcgcgttgt gcactaggtg      2040
     ctgctgggcc agcaagggcg ctgcagtagg cgcgggcgct ggaggcagcg gccctggggg      2100
     cagtggaccc gggcccggcg gaggtggggg acacggcgga ggcgggggat ccctctacag      2160
     cgacgtcagt accggcctga cgtggcggtc tggcacggcc agctctgtat cttaccctaa      2220
     gcaaatgcca ttgtcccagg tctgaaccct acgtggatgc ccagaagggg cggagaggag      2280
     tgggggatgg ggaacccgtg ggcggcgaag ggaccccaga ccggccaggg ttcccacccc      2340
     ttcccagtgt tgactgctat agcatgacaa tgaagtgtta atggtatcca ttagcagcgg      2400
     ggacttaaat gactccctta g                                                2421
//