Dbfetch

ID   U43319; SV 1; linear; mRNA; STD; MUS; 2492 BP.
XX
AC   U43319;
XX
DT   13-JAN-1996 (Rel. 46, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus putative transmembrane receptor (frizzled 6) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2492
RX   DOI; 10.1074/jbc.271.8.4266.
RX   PUBMED; 8626800.
RA   Wang Y., Macke J.P., Abella B.S., Andreasson K., Worley P., Gilbert D.J.,
RA   Copeland N.G., Jenkins N.A., Nathans J.;
RT   "A large family of putative transmembrane receptors homologous to the
RT   product of the Drosophila tissue polarity gene frizzled";
RL   J Biol Chem 271(8):4468-4476(1996).
XX
RN   [2]
RP   1-2492
RA   Abella B., Wang Y., Macke J.P., Nathans J.;
RT   ;
RL   Submitted (14-DEC-1995) to the INSDC.
RL   Jeremy Nathans, Molecular Biology and Genetics, Johns Hopkins Medical
RL   School, 725 N. Wolfe Street, Baltimore, MD 21205
XX
DR   MD5; 1cfd13c05dbcc93c01287352083f4257.
DR   Ensembl-Gn; ENSMUSG00000022297; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000107137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179165; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000202152; mus_musculus.
DR   EuropePMC; PMC30212; 11226313.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2492
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /map="8q22-24"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             146..2275
FT                   /codon_start=1
FT                   /gene="frizzled 6"
FT                   /product="transmembrane receptor"
FT                   /note="putative transmembrane receptor"
FT                   /db_xref="GOA:Q61089"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026543"
FT                   /db_xref="MGI:MGI:108474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61089"
FT                   /protein_id="AAC52431.1"
FT                   /translation="MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNL
FT                   MGHYDQGIAAVEMGHFLHLANLECSPNIEMFLCQAFIPTCTEQIHVVLPCRKLCEKIVS
FT                   DCKKLMDTFGIRWPEELECNRLPHCDDTVPVTSHPHTELSGPQKKSDQVPRDIGFWCPK
FT                   HLRTSGDQGYRFLGIEQCAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLI
FT                   DVRRFRYPERPIIYYSVCYSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKA
FT                   CSVVFMFLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTV
FT                   MLLAMNKVEGDNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQV
FT                   IQHDGRNQEKLKKFMIRIGVFSGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYR
FT                   IPCPYQANPKARPELALFMIKYLMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPIS
FT                   ESRRVLQESCEFFLKHNSKVKHKKKHGAPGPHRLKVISKSMGTSTGATTNHGTSAMAIA
FT                   DHDYLGQETSTEVHTSPEASVKEGRADRANTPSAKDRDCGESAGPSSKLSGNRNGRESR
FT                   AGGLKERSNGSEGAPSEGRVSPKSSVPETGLIDCSTSQAASSPEPTSLKGSTSLPVHSA
FT                   SRARKEQGAGSHSDA"
XX
SQ   Sequence 2492 BP; 651 A; 589 C; 609 G; 643 T; 0 other;
     tcatttcagg cccagctact atcaaaatgg tacaaagaat gcaatgagga atttgtacat        60
     tttatctctg atttgagaat ctttttgatg cggaaaggag cataagaata atccaagcca       120
     tgtggtaaaa tcggagtctg gcaagatgga aaggtccccg tttctgttgg cgtgcattct       180
     tctgcccctc gtaagaggac acagcctttt cacctgtgag ccaatcaccg ttcccagatg       240
     tatgaaaatg acttacaaca tgacgttctt ccctaacctg atgggtcatt atgaccaggg       300
     gatcgctgct gtggaaatgg ggcactttct gcatcttgca aatctagaat gttcaccaaa       360
     cattgaaatg ttcctttgcc aagcttttat accaacctgc acagagcaaa ttcatgtagt       420
     tctaccctgt cggaaattgt gtgagaaaat agtttctgat tgcaaaaaac taatggacac       480
     ttttggcatc cgatggcctg aagaacttga atgtaacaga ttgccacact gtgatgacac       540
     tgttcctgta acttctcatc cacacacaga gctttctggg ccacagaaga aatcagatca       600
     agtcccaaga gacattggat tttggtgtcc aaagcacctt aggacttccg gggaccaagg       660
     ctataggttt ctgggaattg aacagtgtgc ccctccgtgc cccaatatgt attttaaaag       720
     tgatgaacta gactttgcca aaagtttcat aggaatagtt tcaatatttt gtctttgtgc       780
     aactctgttc acgttcctta catttttaat tgacgttaga cgattcagat acccagagag       840
     accaattatc tattactctg tctgctacag cattgtctct ctcatgtact tcgtggggtt       900
     tttgctgggc aatagcacag cttgtaataa ggcagacgag aagctggagc tcggggacac       960
     cgttgtccta gggtcaaaga ataaggcttg cagtgtggta tttatgtttc tgtatttttt      1020
     tacaatggct ggcaccgtgt ggtgggtgat tctcaccatt acgtggttct tagctgccgg      1080
     gagaaaatgg agttgcgaag ctattgaaca aaaagcagtg tggttccatg ccgttgcctg      1140
     gggggcgccc gggttcctga ccgtcatgct gctcgctatg aataaggttg aaggagacaa      1200
     cattagcggc gtttgcttcg ttggcctgta tgacctggac gcctctcgct acttcgtcct      1260
     tctgcctctg tgcctctgcg tatttgttgg gctgtctctc ctcttagccg gcatcatctc      1320
     cttgaatcat gtccgacaag tcatacagca tgatggtcgg aaccaagaga agctaaagaa      1380
     attcatgatt cgcatcggag tcttcagtgg cctgtatctt gtgcccttag tgacacttct      1440
     cggttgctat gtctatgagc tagtgaacag gatcacctgg gagatgacat ggttctctga      1500
     tcattgtcac cagtaccgca tcccgtgccc ttaccaggca aatccaaaag ctcgaccaga      1560
     attggcttta tttatgataa aatatctgat gacattaatt gttggtatct ctgcggtctt      1620
     ctgggttgga agcaaaaaga cgtgcacaga atgggccggg ttctttaagc gaaaccgcaa      1680
     gcgagacccc atcagtgaga gccgccgagt gctgcaagag tcctgtgagt tcttcctgaa      1740
     gcacaactct aaagtgaagc acaagaagaa gcatggcgca ccagggcctc ataggctgaa      1800
     ggtcatttcc aagtccatgg gaactagcac aggagcgacc acaaatcatg gcacctctgc      1860
     catggcaatc gctgaccatg attacttagg gcaagaaact tcaacagaag tccacacctc      1920
     cccagaagca tccgtcaaag agggacgagc agaccgagca aacactccca gcgccaaaga      1980
     tcgggactgt ggggaatctg cagggcccag ttccaagctc tctgggaacc ggaacggcag      2040
     ggaaagccga gcgggcggcc tgaaggagag aagcaatgga tcagaggggg ctccaagtga      2100
     aggaagggta agtccaaaga gcagcgttcc tgagactggc ctgatagact gcagcacttc      2160
     acaggccgcc agttctccag aaccaaccag cctcaagggc tccacatctc tgcctgttca      2220
     ctcagcttcc agagctagga aagagcaggg tgctggcagc cattccgacg cttgaagaaa      2280
     actgtctcgt tcccccagaa gcacatgtat gttacactgg agatgaccaa ctgatttgtc      2340
     ttataaaggc cactgttgag ctgggagagt agcccagtgg tacagcgccc acctggaata      2400
     ctgaggacct ggggttgtct cccagcactg caaaaggaaa attcactgtt acagtcttcc      2460
     ttgcacttaa ccagctttgt ctatgttttt tt                                    2492
//