spacer

EBI Dbfetch

ID   U42383; SV 1; linear; mRNA; STD; MUS; 2069 BP.
XX
AC   U42383;
XX
DT   08-JUN-1996 (Rel. 48, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus fibroblast growth factor inducible gene 13 (FIN13) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2069
RX   PUBMED; 8649829.
RA   Guthridge M.A., Seldin M., Basilico C.;
RT   "Induction of expression of growth-related genes by FGF-4 in mouse
RT   fibroblasts";
RL   Oncogene 12(6):1267-1278(1996).
XX
RN   [2]
RP   1-2069
RX   PUBMED; 9271424.
RA   Guthridge M.A., Bellosta P., Tavoloni N., Basilico C.;
RT   "FIN13, a novel growth factor-inducible serine-threonine phosphatase which
RT   can inhibit cell cycle progression";
RL   Mol. Cell. Biol. 17(9):5485-5498(1997).
XX
RN   [3]
RP   1-2069
RA   Guthridge M.A.;
RT   ;
RL   Submitted (07-DEC-1995) to the INSDC.
RL   Microbiology, NYU Medical Center, 550 First Ave., New York, NY 10016, USA
XX
RN   [4]
RC   Sequence update by submitter
RP   1-2069
RA   Bellosta P.;
RT   ;
RL   Submitted (14-JUL-1998) to the INSDC.
RL   Microbiology, NYU Medical Center, 550 First Ave., New York, NY 10016, USA
XX
DR   MD5; b507a64536e2ea7c017450f75c7627be.
DR   Ensembl-Gn; ENSMUSG00000029147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031032; mus_musculus.
XX
CC   On Jul 14, 1998 this sequence version replaced gi:1353704.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2069
FT                   /organism="Mus musculus"
FT                   /chromosome="5"
FT                   /map="5; between Il6 and Qdpr"
FT                   /mol_type="mRNA"
FT                   /cell_type="FGF-4 transformed fibroblasts"
FT                   /db_xref="taxon:10090"
FT   CDS             10..1638
FT                   /codon_start=1
FT                   /gene="FIN13"
FT                   /product="fibroblast growth factor inducible gene 13"
FT                   /note="similar to serine/threonine type 2C phosphatase;
FT                   Method: conceptual translation supplied by author."
FT                   /db_xref="GOA:Q61074"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:106065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61074"
FT                   /protein_id="AAC26322.1"
FT                   /translation="MGAYLSQPNTVKCSGDGVGAPRLPLPYGFSAMQGWRVSMEDAHNC
FT                   IPELDNETAMFSVYDGHGGEEVALYCAKYLPDIIKDQKAYKEGKLQKALQDAFLAIDAK
FT                   LTTEEVIKELAQIAGRPTEDEDDKDKVADEDDVDNEEAALLHEEATMTIEELLTRYGQN
FT                   CQKVPPHTKSGIGTGDEPGPQGLNGEAGPEDPSRETPSQENGPTAKGHTGFSSNSEHGT
FT                   EAGQISEPGTATGEAGPSCSSASDKLPRVAKSKFFEDSEDESDEVEEEEDDSEECSEDE
FT                   DGYSSEEAENEEDEDDTEEAEEDDDEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIV
FT                   ANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGD
FT                   HFYKRNKNLPPQEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKIS
FT                   QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTVELQAESGKR
FT                   KLEEALSTEGAEDTGNSDKKKAKRD"
XX
SQ   Sequence 2069 BP; 538 A; 487 C; 601 G; 443 T; 0 other;
     gccgccgcca tgggtgccta cctctctcag cccaacacgg tgaagtgctc cggggacggg        60
     gttggcgccc cgcggctccc gctgccctac ggcttctccg ccatgcaagg ctggcgcgtc       120
     tccatggagg atgctcacaa ctgtattcct gagctggaca atgagacagc catgttttct       180
     gtctacgatg gacatggagg ggaagaggtt gccttgtact gtgccaaata tcttcctgat       240
     attatcaaag atcagaaggc ctacaaggaa ggcaagcttc agaaggcttt acaagatgcc       300
     ttcttggcta ttgatgccaa gctgaccaca gaggaagtca ttaaggaact ggcccagatt       360
     gcagggagac ccactgaaga tgaggatgat aaagacaaag tagcagatga ggatgatgtg       420
     gacaatgagg aggctgcatt gttgcatgaa gaggctacca tgactattga agagctgctg       480
     acgcgatatg ggcagaactg tcagaaggtc cctccccaca ccaaatctgg aattgggaca       540
     ggcgatgaac cagggcccca gggcctcaat ggggaggctg gacctgagga cccatctagg       600
     gaaactcctt cccaggaaaa tggccccaca gccaaaggcc acacaggctt ttcctccaac       660
     tcggaacatg ggactgaggc aggccaaatt agtgagcccg gtactgctac cggtgaggct       720
     ggaccttcct gctcttcagc ctctgacaag ctgcctcgag ttgctaagtc caagttcttt       780
     gaggacagtg aagatgaatc agatgaggtg gaggaagagg aggatgacag tgaggaatgt       840
     agtgaggacg aggacggcta cagcagtgag gaggcagaga acgaggaaga cgaggatgac       900
     acggaggagg ctgaagagga tgatgatgaa gagatgatgg tccctggaat ggaaggcaaa       960
     gaagagcctg gttctgacag tggcacaaca gcggtggtgg ctctgatcag agggaagcag      1020
     ttgattgtgg ccaatgcagg agactctcgc tgtgtggtgt ccgaggctgg caaagcttta      1080
     gatatgtcct atgaccacaa accagaggat gaagtggagc tggcacgcat caagaatgct      1140
     ggtggcaagg tcaccatgga tggacgagtc aatggaggcc tcaacctctc cagggccatt      1200
     ggagaccact tctacaagag aaacaaaaac ttgccacccc aggaacagat gatttctgcc      1260
     cttcctgaca tcaaggtgct gactctcact gatgaccatg aattcatggt cattgcttgt      1320
     gacggcatct ggaatgtgat gagcagccag gaggttgtag actttattca atcaaagatc      1380
     agtcaacgtg atgaaaacgg ggagcttcgg ttattgtcat ccattgtgga agagctgctg      1440
     gatcagtgcc tggcgccaga cacttctggg gatggtacag ggtgtgacaa catgacgtgc      1500
     atcatcattt gcttcaagcc ccgaaacaca gtagagcttc aggcagagag tggcaagagg      1560
     aaactggagg aggcactgtc cacggagggg gctgaagaca ccggcaacag tgacaaaaag      1620
     aaggccaaga gggactagtg gtcaaccgga ccctgcccat gtggactgtt ttctgagccc      1680
     ttggacccga gactgagttt tgtccttgtc ctttagcctt agcagtgggt atgaggtgtg      1740
     cagggggctg ggtggctttc ctcagcccat tacaaagagg gccccccacc ccccccacgc      1800
     ggcagcctgg gaggctctgc tgtcctctta agcctcctta ctctccttgg gctcatcgac      1860
     tatcggttct gtgcctgtgc tctgttgtgt tggagggaag gactggtagt tctgattttt      1920
     actctgtgaa cactttattt aaggacattc ttttttattg gcggctctgt gacccctagc      1980
     cgcttgcacc cgctctctgt tgtacacttt caagcaacac tttttcagac taaaggccaa      2040
     acaaaagcta aaaaaaaaaa aaaaaaaaa                                        2069
//


spacer
spacer