Dbfetch

ID   U41568; SV 1; linear; mRNA; STD; MUS; 1818 BP.
XX
AC   U41568;
XX
DT   02-JUN-1996 (Rel. 47, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus nuclear hormone receptor Ahch (Ahch) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1818
RX   DOI; 10.1016/0378-1119(96)00320-4.
RX   PUBMED; 8921887.
RA   Guo W., Lovell R.S., Zhang Y.H., Huang B.L., Burris T.P., Craigen W.J.,
RA   McCabe E.R.;
RT   "Ahch, the mouse homologue of DAX1: cloning, characterization and synteny
RT   with GyK, the glycerol kinase locus";
RL   Gene 178(1-2):31-34(1996).
XX
RN   [2]
RP   1-1818
RA   Guo W., Lovell R.S., Zhang Y.-H., Huang B.-L., Burris T.P., Craigen W.J.,
RA   McCabe E.R.B.;
RT   ;
RL   Submitted (30-NOV-1995) to the INSDC.
RL   Weiwen Guo, Pediatrics, UCLA School of Medicine, 10833 Le Conte Ave., Los
RL   Angeles, CA 90024-1752, USA
XX
DR   MD5; 5c4bdbb07a118fb1f4d62a2d290f75d9.
DR   Ensembl-Gn; ENSMUSG00000025056; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035892; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035877; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035795; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035858; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035568; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036389; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034857; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035543; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035698; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035637; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035787; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035674; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036416; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034555; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034996; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000026036; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0096796; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0096892; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0096827; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0096808; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0096359; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0097313; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096944; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0096276; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0096488; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0096320; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0096518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0096273; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0097669; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0096351; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0095329; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1818
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /strain="inbred CD-1"
FT                   /mol_type="mRNA"
FT                   /tissue_type="testes"
FT                   /db_xref="taxon:10090"
FT   CDS             26..1444
FT                   /codon_start=1
FT                   /gene="Ahch"
FT                   /product="nuclear hormone receptor Ahch"
FT                   /note="homolog of human DAX1, the gene responsible for
FT                   X-linked adrenal hypoplasia congenita and hypogonadotropic
FT                   hypogonadism; member of the nuclear hormone receptor
FT                   superfamily"
FT                   /db_xref="GOA:Q61066"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR025900"
FT                   /db_xref="InterPro:IPR033544"
FT                   /db_xref="InterPro:IPR035500"
FT                   /db_xref="MGI:MGI:1352460"
FT                   /db_xref="PDB:3F5C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61066"
FT                   /protein_id="AAC52920.1"
FT                   /translation="MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGA
FT                   QPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAP
FT                   CWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSRE
FT                   APEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSA
FT                   DQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILP
FT                   LDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQA
FT                   TEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCV
FT                   KYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAV
FT                   SMDDMMLEMLCAKL"
XX
SQ   Sequence 1818 BP; 437 A; 483 C; 509 G; 389 T; 0 other;
     gaattcggac gaggagcctc aggccatggc gggtgaggac cacccgtggc agggcagcat        60
     cctctacaat ctactgatga gcgcgaagca gaagcacgcg tctcaggaag agcgagaggt       120
     gcgcttgggg gctcagtgct ggggttgcgc ctgcggtgct cagcccgtcc tgggtgggga       180
     gagactgtcc ggcgggcaag ccaggtccct cttgtaccgc tgctgctttt gtggggagaa       240
     tcacccgcgc cagggtggca tcctctactc tatgctcacc aacgccaggc agccaagcgt       300
     ggcgacccag gcgccgaggg cacgattcgg agcaccttgc tggggctgcg cctgcggcag       360
     cgcagagccc ctggtgggca gagaggggct gccggctggc caggccccct cgctcctgta       420
     ccgctgttgt ttctgcggag aagagcaccc gaggcagggc agcatcttat acagcttgct       480
     cactagcgct cagcaaacgc acgtgtctcg ggaagcaccc gaggcacatc gcagaggcga       540
     gtggtggcag ctgtcctact gtacccagag tgtgggtggc ccagaggggc tgcagagcac       600
     acaggccatg gcgttcctgt accgcagcta tgtgtgcggt gaagagcagc cccagcagat       660
     cagcgttgcc tctggcacgc ccgtgagcgc agaccaaaca ccagcgaccc cgcaagagca       720
     gccgagggct ccctggtggg acgcctcacc tggtgtgcag cgtctgatca cactcaagga       780
     tccacaggtg gtgtgcgagg cagcgtccgc tggcctgttg aagaccctgc gctttgtcaa       840
     gtacttgccc tgcttccaga tcctgcccct agatcagcag ctggtgctgg tgcggagctg       900
     ttgggcgccc ctactcatgc ttgagttggc ccaagatcac ctgcacttcg agatgatgga       960
     gatcccggag accaacacga cgcaggaaat gcttaccacc aggcggcagg agaccgaagg      1020
     tccagagcct gcagagcccc aggccacaga gcagccacag atggtgtccg cggaggctgg      1080
     gcacttgctc ccagctgctg cggtccaggc catcaagagt ttctttttca agtgctggag      1140
     tctgaacatt gacaccaaag agtatgccta tctgaaaggg accgtgctct ttaacccaga      1200
     cctgcctggc ctgcagtgcg tgaaatacat tgagggtctt cagtggagaa cccagcagat      1260
     ccttactgag cacatccgga tgatgcagag agagtaccag atcagatccg ctgaactgaa      1320
     cagtgccctt ttcctgctga gattcatcaa tagcgatgtc gtcactgaac tctttttcag      1380
     gcccatcatt ggtgcagtca gcatggatga tatgatgctg gagatgctct gtgcaaagct      1440
     gtgaaggcat atgtccactc aagtgcattt tactatagat ggagaaagcg gtcgtagctg      1500
     taggcagaag agtgctaaaa tttgtgaaac caaactttct tgtattttta catgcatagt      1560
     atatttgtat tcaattgaag aaatacttta gttacaatgt aaaaatccct ctgctccata      1620
     ctggcttctt gtgaaggaaa gcatttgcaa acaaatcact atttctgtat atctctaaga      1680
     gtgtggtact aggctaacaa gctaatttca taaaaataac atctctttcc attaaccccg      1740
     ccaaataaaa tttataatat taacttttaa taaaatttaa ggtactaacc gtaaaaaaaa      1800
     aaaaaaaaaa acctcgag                                                    1818
//