spacer

EBI Dbfetch

ID   U41489; SV 1; linear; genomic DNA; STD; HUM; 288 BP.
XX
AC   U41489;
XX
DT   26-DEC-1995 (Rel. 46, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 6)
XX
DE   Human MHC class II histocompatibility antigen beta chain, isolate BY00002,
DE   HLA-DRB1  (DRB1-14variant allele) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-288
RA   Hurley Carolyn.;
RT   ;
RL   Submitted (29-NOV-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology, Georgetown University School of Medicine,
RL   3970 Reservior Rd. NW, Wshington, DC 20007, USA
XX
DR   MD5; 09bb26b94ea317bf6e33338159d1a28d.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..288
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="BY00002"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   CDS             <19..>288
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA beta chain"
FT                   /note="DRB1-14variant allele"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:24"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAA86242.1"
FT                   /translation="SECHFFNGTERVRFLERYFHNQEENVRFDSDVGEYRAVTELGRPD
FT                   AEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVHPKVTVY"
XX
SQ   Sequence 288 BP; 61 A; 68 C; 103 G; 56 T; 0 other;
     ttcttggagt actctacgtc tgagtgtcat ttcttcaatg ggacggagcg ggtgcggttc        60
     ctggagagat acttccataa ccaggaggag aacgtgcgct tcgacagcga cgtgggggag       120
     taccgggcgg tgacggagct ggggcggcct gatgccgagt actggaacag ccagaaggac       180
     atcctggagc aggcgcgggc cgcggtggac acctactgca gacacaacta cggggttggt       240
     gagagcttca cagtgcagcg gcgagtccat cctaaggtga ctgtgtat                    288
//


spacer
spacer