spacer

EBI Dbfetch

ID   U41047; SV 1; linear; mRNA; STD; MUS; 2225 BP.
XX
AC   U41047;
XX
DT   14-FEB-1996 (Rel. 46, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus transcription factor Genesis mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2225
RX   DOI; 10.1074/jbc.271.38.23126.
RX   PUBMED; 8798505.
RA   Sutton J., Costa R., Klug M., Field L., Xu D., Largaespada D.A.,
RA   Fletcher C.F., Jenkins N.A., Copeland N.G., Klemsz M., Hromas R.;
RT   "Genesis, a winged helix transcriptional repressor with expression
RT   restricted to embryonic stem cells";
RL   J Biol Chem 271(38):23126-23133(1996).
XX
RN   [2]
RP   1-2225
RX   DOI; 10.1073/pnas.90.9.3948.
RX   PUBMED; 7683413.
RA   Clevidence D.E., Overdier D.G., Tao W., Qian X., Pani L., Lai E.,
RA   Costa R.H.;
RT   "Identification of nine tissue-specific transcription factors of the
RT   hepatocyte nuclear factor 3/forkhead DNA-binding-domain family";
RL   Proc. Natl. Acad. Sci. U.S.A. 90(9):3948-3952(1993).
XX
RN   [3]
RP   1-2225
RA   Hromas R.A.;
RT   ;
RL   Submitted (20-NOV-1995) to the INSDC.
RL   Robert A. Hromas, Indiana University Medical Center, Department of
RL   Medicine, 975 W. Walnut St., Indianapolis, IN 46202, USA
XX
DR   MD5; 2d230b6dc7c23704aa7b0e54336a88ef.
DR   Ensembl-Gn; ENSMUSG00000067261; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087285; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2225
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="embryo"
FT                   /clone="3A and 4C"
FT                   /cell_line="PCC4, P19, NT2D1, Tera 1"
FT                   /cell_type="stem cells and carcinoma cells"
FT                   /db_xref="taxon:10090"
FT   CDS             320..1717
FT                   /codon_start=1
FT                   /product="Genesis"
FT                   /note="a winged helix retinoic-acid hepatocyte nuclear
FT                   factor 3/forkhead transcription factor; HNF3/FH
FT                   transcription factor"
FT                   /db_xref="GOA:Q61060"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:1347473"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61060"
FT                   /protein_id="AAA87569.1"
FT                   /translation="MTLSGSGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSDAGCD
FT                   SPAGPPDLRLDEADEGPPVSAHHGQSQPQALALPTEATGPGNDTGAPEADGCKGGEDAV
FT                   TGGGGPGAGSGATGGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISN
FT                   RFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLR
FT                   RRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAGPYGLHPAAAAGAYSHPAAAAAAA
FT                   GCCGAPVPVRATTRGSRAAARSAPAALGRAGPQSGRLRLAARSEPAATAQHPGRRRGSR
FT                   GHGGRGGHHVAHQVRAQCAAVVQHREHHRRGIRAPGGSAGGGGSGGGAGGGGGSGGGGG
FT                   AQSFLRPPGTVQSAALMATHQPLSLSRTTATIAPILSVPLSGQFLQPAASAAAAAAAAV
FT                   QAKWPAQ"
XX
SQ   Sequence 2225 BP; 393 A; 759 C; 714 G; 359 T; 0 other;
     gtcgaggaag gctggtgaag tgagggggtg cggcgtggag aaacctccgg ggtcgcgagc        60
     agtagctgtc tcctcgtaga gaagcgtcga ggaccgcaag agttcgcgga cgcgggctgc       120
     ggacgcagcc ccacaccgct gccaggcctc ctcgtgtgag ctgacccgac agccccgagc       180
     tacctgtgcc ctctcccccc ctcccccggc tttctttcgg gggacactca cacctccttt       240
     gcctgagctc cgcgccgccc ctcgcggccc ccctcgctct ctgctcgctc ctggccgccg       300
     ccaccaaccc cgcggaggga tgaccctctc cggcagcggc agcgccagcg atatgtccgg       360
     ccagacggtg ctgacggccg aggacgtgga catcgatgtg gtgggcgagg gcgacgacgg       420
     gctggaggag aaggacagcg acgccgggtg cgacagcccc gcggggcctc cggacctgcg       480
     cctggacgag gcggacgaag ggccaccggt gagcgctcat cacggccagt ctcaaccgca       540
     agccctggca ctgcccaccg aggcgaccgg gccggggaac gacacgggag ctccggaggc       600
     cgacggctgc aagggcggcg aggacgcggt gacaggcggc ggtgggcccg gcgcgggcag       660
     cggggcgacg ggaggtctga ccccgaacaa gcccaagaac agcctggtga agccacccta       720
     ctcttacatc gcgctcatca ccatggccat cctgcagagc ccgcagaaga agctgaccct       780
     gagcggcatc tgcgagttca tcagcaaccg ttttccgtac taccgggaga agttccccgc       840
     ctggcagaac agcatccgcc acaacctgtc gctcaacgac tgcttcgtca agatcccccg       900
     cgagccgggc aacccgggca agggcaacta ctggaccctg gacccccagt ccgaggacat       960
     gttcgacaac ggcagcttcc tgcggcgccg gaagcgcttc aagcgccacc agcaggagca      1020
     cctgcgcgag cagacggcgc tgatgatgca gagcttcgga gcctacagcc tggcggcggc      1080
     ggcgggcgca ggaccctacg gcctgcaccc cgcggcggct gcgggcgcct actcgcaccc      1140
     cgcggcggcg gcggcggccg cgggctgctg cggcgctcca gtacccgtac gcgctaccac      1200
     ccgtggctcc cgtgctgccg cccgcagtgc ccctgctgcc ctcgggcgag ctgggccgca      1260
     aagcggccgc cttcggctcg cagctcggtc cgagcctgca gctacagctc aacaccctgg      1320
     gcgccgccgc ggcagccgcg ggcacggcgg gcgcggcggg caccacgtcg ctcatcaagt      1380
     ccgagcccag tgcgcggccg tcgttcagca tcgagaacat cataggcgcg ggatccgggc      1440
     gcccgggggc tcggctgggg gtggtgggag cggcggcgga gccgggggtg gcgggggcag      1500
     tgggggcggc ggcggcgcgc agtccttcct gcggccgccc gggactgtgc agtcggctgc      1560
     gctcatggcc acgcaccagc ccctgtcgct gagccggacg actgccacca tcgcgcccat      1620
     tctgagcgtg ccgctgtctg gacagttcct gcagcccgca gcctcagccg cagcggctgc      1680
     ggccgccgcc gtgcaagcca agtggcccgc tcaatagtga tgagctagtg gccgggccgg      1740
     acggcggcct ctggcagcag cctgctcttc caggcggtac gccctctctg atcctggtcc      1800
     atctgtcctg gtcctggtcc tggtccctct acccaatcct ggactctgct acccgccccc      1860
     gactccccaa cactgaccaa cagcggcctc catcccctca ctcacctaag ctggcggagc      1920
     aaactcaacc cgtccgctgg gaataacttt ccagtacagg taaaactgat aaccgaattt      1980
     ccaaaaatgc accccgacgg cgccgttgtt ctcagtactg tgggggtggg agggacattc      2040
     tttgtacata tttgtataaa aatcattgac tttccttttg gggtttttat ttttttaaga      2100
     aaataaaaag caattcagta gatttagagc tttgaacttt catatttttt tgaaggttca      2160
     ctctgcgcag ttttatctga gaaaagaatg tataaagact tgggagattt aaatacaaaa      2220
     aattt                                                                  2225
//


spacer
spacer