spacer

EBI Dbfetch

ID   U40981; SV 1; linear; mRNA; STD; MUS; 315 BP.
XX
AC   U40981;
XX
DT   12-JUN-1996 (Rel. 48, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Mus musculus trp-related protein 2 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-315
RX   DOI; 10.1016/S0092-8674(00)81233-7.
RX   PUBMED; 8646775.
RA   Zhu X., Jiang M., Peyton M., Boulay G., Hurst R., Stefani E.,
RA   Birnbaumer L.;
RT   "trp, a novel mammalian gene family essential for agonist-activated
RT   capacitative Ca2+ entry";
RL   Cell 85(5):661-671(1996).
XX
RN   [2]
RP   1-315
RA   Zhu X.;
RT   ;
RL   Submitted (17-NOV-1995) to the INSDC.
RL   Xi Zhu, Anesthesiology, UCLA, 10833 Le Conte Ave., BH612, CHS, Los Angeles,
RL   CA 90095-1778, USA
XX
DR   MD5; 046bffa382839c95e64b29f2b01d2638.
DR   Ensembl-Gn; ENSMUSG00000070425; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106943; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124189; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..315
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>315
FT                   /codon_start=1
FT                   /product="trp-related protein 2"
FT                   /note="Drosophila trp homolog"
FT                   /db_xref="GOA:Q61057"
FT                   /db_xref="InterPro:IPR002153"
FT                   /db_xref="InterPro:IPR005458"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="MGI:MGI:109527"
FT                   /db_xref="UniProtKB/TrEMBL:Q61057"
FT                   /protein_id="AAC52700.1"
FT                   /translation="DDMIRFMFILMIILTAFLCGLNNIYVPYQESEKLGNFNETFQFLF
FT                   WTMFGMEEHTVVDMPQFLVPEFVGRAMYGIFTIVMVIVLLNMLIAMITNSFQKIEDDAD
FT                   V"
XX
SQ   Sequence 315 BP; 71 A; 83 C; 73 G; 88 T; 0 other;
     gacgacatga tccggttcat gttcatcctc atgatcatcc tgactgcctt cctctgtggc        60
     ctcaacaaca tctatgtgcc ctaccaggaa tccgagaagc taggcaattt caacgaaacg       120
     ttccagtttc tcttttggac catgttcggc atggaagagc acacagtggt ggacatgcct       180
     cagttcctgg tgcctgagtt cgtgggcagg gccatgtacg gcatctttac catcgtcatg       240
     gtcattgtgc tacttaacat gcttattgcc atgatcacca actccttcca gaagatcgag       300
     gatgatgctg atgtg                                                        315
//


spacer
spacer