spacer

EBI Dbfetch

ID   U39391; SV 1; linear; mRNA; STD; MUS; 2376 BP.
XX
AC   U39391; S67168;
XX
DT   20-NOV-1995 (Rel. 45, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus serotonin1A receptor mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2376
RX   PUBMED; 8254366.
RA   Charest A., Wainer B.H., Albert P.R.;
RT   "Cloning and differentiation-induced expression of a murine serotonin1A
RT   receptor in a septal cell line";
RL   J. Neurosci. 13(12):5164-5171(1993).
XX
RN   [2]
RP   1-2376
RA   Charest A., Wainer B.H., Albert P.R.;
RT   ;
RL   Submitted (24-OCT-1995) to the INSDC.
RL   Alain Charest, Biochemistry, McGill University, 3655 Drummond St.,
RL   Montreal, Que H3G 1Y6, Canada
XX
DR   MD5; 98706fbffdc5797211d139f088100c51.
DR   Ensembl-Gn; ENSMUSG00000021721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000022235; mus_musculus.
XX
CC   On Nov 20, 1995 this sequence version replaced gi:455826.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2376
FT                   /organism="Mus musculus"
FT                   /strain="NIH Swiss"
FT                   /mol_type="mRNA"
FT                   /dev_stage="18-d-old"
FT                   /clone_lib="lambda gt11 cDNA library constructed by J.
FT                   Kamholz, C. Puckett, and R. A. Lazzarini, NINCDS"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             70..1335
FT                   /codon_start=1
FT                   /product="serotonin1A receptor"
FT                   /note="5-HT1A receptor;  Plasma membrane 7-transmembrane
FT                   receptor"
FT                   /db_xref="GOA:Q64264"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000610"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:96273"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64264"
FT                   /protein_id="AAA81519.1"
FT                   /translation="MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGT
FT                   LIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTL
FT                   GQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLI
FT                   GFLISIPPMLGWRAPEDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAA
FT                   RFRIRKTVKKVEKKGAGTSFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAV
FT                   RQGEDDATLEVIEVHRVGNSKGDLPLPSESGATSYVPACLERKNERTAEAKRKMALARE
FT                   RKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVI
FT                   YAYFNKDFQNAFKKIIKCKFCR"
XX
SQ   Sequence 2376 BP; 517 A; 646 C; 615 G; 598 T; 0 other;
     cgcgagggag atccccttgc atttcttttt ccctcccttc cgcccacccc agcgggagtg        60
     caggcaggca tggatatgtt cagtcttggc cagggcaaca acaccacaac gtccctggag       120
     cccttcggga caggcggcaa cgatactggc ctctccaacg tgaccttcag ctaccaagtg       180
     atcacctctc ttttgctggg gacgctcatt ttctgcgcgg tgctcggcaa tgcctgcgtg       240
     gttgctgcca tcgccctgga gcgctccctt cagaatgttg ccaactatct catcggctcc       300
     ttggcggtca ccgatctcat ggtgtcagtg ctggtgctgc ccatggctgc tctgtaccag       360
     gtgctcaaca agtggactct gggtcaggtc acctgtgacc tgtttatcgc cctggatgtg       420
     ctgtgctgca cttcgtccat cctgcacctg tgcgccatcg cgctagacag gtactgggca       480
     atcaccgacc ctatagacta cgtgaacaag aggacgcccc ggcgcgccgc tgcgctgatc       540
     tcgctcactt ggctcattgg ctttctcatc tccatcccgc ctatgctggg ctggcgcgcc       600
     ccggaagacc gctcgaaccc caacgagtgc accatcagca aggaccacgg gtacaccatc       660
     tactccactt tcggcgcttt ctatattccg ctgctgctca tgctggtcct ctatgggcgc       720
     atcttcagag ccgcgcgctt ccgaatccgc aagacggtca agaaggtgga aaagaaggga       780
     gcgggcacca gcttcggaac atcgtcggcc ccgcccccca agaagagcct gaatggtcag       840
     ccaggtagtg gggactgcag gcgcagtgct gagaacaggg cggtggggac tccgtgcgct       900
     aatggggcgg tgagacaggg tgaggacgac gccaccctgg aggtgatcga ggtgcatcga       960
     gtgggcaact ccaaagggga ccttcctctg cccagcgaat caggagctac ctcctatgtc      1020
     cccgcctgct tggagagaaa aaatgagcgc actgctgagg caaagcgcaa gatggccttg      1080
     gcccgtgaga ggaagacagt gaagacactg ggcatcatca tgggcacctt catcctctgc      1140
     tggctgccct ttttcattgt ggcgctggtc ctacctttct gtgagagcag ttgccacatg      1200
     cctgagttgt tgggtgccat aattaactgg ctaggctact ccaactccct gctcaaccca      1260
     gttatttatg cttatttcaa caaagacttt caaaacgctt ttaagaagat catcaagtgc      1320
     aagttctgcc gctgatgatg atgatggtgg tggtagtggt ggtaatagtg gtggtgatgg      1380
     agaaggaaga agtggaggaa gagtgtaggg cttacaggac ccttcctgtt cactcaatat      1440
     ccccgccctg gaagcaacac ctaagaaaac ttgcttttcc tagaacacgc agcttcttag      1500
     cccatggctt tcagatcttc tctctctatc tcattttaag gggacagtgc tttttgcaga      1560
     aatcttagag aacccctagc atctgtttgt aaaattattg gctcggtctt tggccctagg      1620
     atcagttttg atagttgcaa taacctcctc tctattcgaa atcccaattc ttcacgatgg      1680
     aagtttaaac ctcggcgatt caaggaagaa aacccaaaca gaaaatataa actgtatgga      1740
     catctaccat gcccactagg actgccaccc tctgccctat atctggaact ttgaggttca      1800
     agactgctct gtctctccct ccctccttcc tctagaaaca tctgttccct ttgggtgtca      1860
     atgtacactg ctgattctgg tctccatgca ctcacggctg gtctgggaaa gttggaacta      1920
     ctttgggtta tggtgccctg gaattgtttg ccttgctgaa tagcaaaaga tccctttccc      1980
     caatgcacag cacccacttt ctgtattttg tttgtttgtt tgttttaact caaaatcaag      2040
     tgacaaagat gtctgctgga gtggacttat aagcaagaag ccaggcccaa aaggaagagc      2100
     caagaaggcc tgcggatgtt ttcctgtcct ggtgtcagca ctcaccaaag aaattgacaa      2160
     tcagactatt tggaaggaag agttttattc ctgtagtttg ttggcttttc tgtaagttct      2220
     ggaaaggcct tgtggactgc agaaggcgcc cactgctggc cagggagggc tcattgaggg      2280
     tgctgagatg cccgggatgg ctcacctcac cctcagtttc ttttctagga gtgagctatg      2340
     ccagagcagc tcaccttgag tttgcagcct tcgggg                                2376
//


spacer
spacer