Dbfetch

ID   U38499; SV 1; linear; mRNA; STD; MUS; 126 BP.
XX
AC   U38499;
XX
DT   08-JUN-1996 (Rel. 48, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 4)
XX
DE   Mus musculus oocyte G protein gamma 7 subunit mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-126
RX   DOI; 10.1002/(SICI)1098-2795(199607)44:3<315::AID-MRD5>3.3.CO;2-V.
RX   PUBMED; 8858601.
RA   Williams C.J., Schultz R.M., Kopf G.S.;
RT   "G protein gene expression during mouse oocyte growth and maturation, and
RT   preimplantation embryo development";
RL   Mol. Reprod. Dev. 44(3):315-323(1996).
XX
RN   [2]
RP   1-126
RA   Williams C.J., Kopf G.S., Schultz R.M.;
RT   ;
RL   Submitted (13-OCT-1995) to the INSDC.
RL   Carmen J. Williams, Ob/Gyn, Univ. of Pennsylvania, 226 Leidy Lab,38th St. &
RL   Hamilton Walk, Philadelphia, PA 19104-6018, USA
XX
DR   MD5; 4d886ca30d73e0e79dd2b1cf0b35d2d3.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017508; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017470; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017924; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016860; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017265; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017371; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017965; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016920; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000117805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118465; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026361; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026333; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026301; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026307; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026110; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026155; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025389; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025639; mus_musculus_wsbeij.
DR   EuropePMC; PMC310909; 10984455.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..126
FT                   /organism="Mus musculus"
FT                   /strain="CF1, Harlan"
FT                   /mol_type="mRNA"
FT                   /cell_type="oocyte"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>126
FT                   /codon_start=1
FT                   /product="G protein gamma 7 subunit"
FT                   /db_xref="GOA:Q61016"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61016"
FT                   /protein_id="AAB01730.1"
FT                   /translation="ARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARNDPLLVG"
XX
SQ   Sequence 126 BP; 26 A; 36 C; 40 G; 24 T; 0 other;
     gcccggaagc tggtggagca gctgcgcatt gaagctggga tcgaacgcat caaggtctcc        60
     aaggcctcgt cagacctgat gggctactgt gagcaacatg cccgcaacga tcccttgctg       120
     gttggc                                                                  126
//