spacer

EBI Dbfetch

ID   U37119; SV 1; linear; genomic DNA; STD; MUS; 873 BP.
XX
AC   U37119;
XX
DT   03-NOV-1995 (Rel. 45, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 3)
XX
DE   Mus musculus arylamine N-acetyltransferase (NAT1) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-873
RA   Hein D.W., Doll M.A.;
RT   ;
RL   Submitted (27-SEP-1995) to the INSDC.
RL   Mark A. Doll, Pharmacology and Toxicology, University of North Dakota, 501
RL   North Columbia Road, Grand Forks, ND 58202, USA
XX
DR   Ensembl-Gn; ENSMUSG00000025588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026677; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..873
FT                   /organism="Mus musculus"
FT                   /strain="C3H/HeJ"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="heart"
FT                   /db_xref="taxon:10090"
FT   CDS             1..873
FT                   /codon_start=1
FT                   /gene="NAT1"
FT                   /product="arylamine N-acetyltransferase"
FT                   /db_xref="GOA:P50294"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:97279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50294"
FT                   /protein_id="AAA80667.1"
FT                   /translation="MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCG
FT                   EAMHLDLQDIFDHIVRKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSE
FT                   MVHLLVQVTISDRKYIVDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQ
FT                   IRREQYVPNEEFVNSDLLEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSF
FT                   CSLQTSEGVHCLVGSTFTSRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVP
FT                   KHGELVFTI"
XX
SQ   Sequence 873 BP; 260 A; 163 C; 207 G; 243 T; 0 other;
     atggacatcg aagcatactt tgaaaggatt ggttacaaga actcagtgaa taaattggac        60
     ttagccacat taactgaagt tcttcagcac cagatgcgag cagttccttt tgagaatctt       120
     aacatgcatt gtggagaagc catgcatctg gatttacagg acatttttga ccacatagta       180
     aggaagaaga gaggtggatg gtgtctccag gttaatcatc tgctgtactg ggctctgacc       240
     aaaatgggct ttgaaaccac aatgttggga ggatatgttt acataactcc agtcagcaaa       300
     tatagcagtg aaatggtcca ccttctagta caggtgacca tcagtgacag gaagtacatt       360
     gtggattccg cctatggagg ctcctaccag atgtgggagc ctctggaatt aacatctggg       420
     aaggatcagc ctcaggtgcc tgccatcttc cttttgacag aggagaatgg aacctggtac       480
     ttggaccaaa tcagaagaga gcagtatgtt ccaaatgaag aatttgttaa ctcagacctc       540
     cttgaaaaga acaaatatcg aaaaatctac tcctttactc ttgagccccg agttatcgag       600
     gattttgaat atgtgaatag ctatcttcag acatcgccag catctgtgtt tgtaagcaca       660
     tcgttctgtt ccttgcagac ctcggaaggg gttcactgtt tagtgggctc cacctttaca       720
     agtaggagat tcagctataa ggacgatgta gatctggttg agtttaaata tgtgaatgag       780
     gaagaaatag aagatgtact gaaaaccgca tttggcattt ctttggagag aaagtttgtg       840
     cccaaacatg gtgaactagt ttttactatt tag                                    873
//


spacer
spacer