Dbfetch

ID   U36825; SV 1; linear; genomic DNA; STD; HUM; 265 BP.
XX
AC   U36825;
XX
DT   03-NOV-1995 (Rel. 45, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 8)
XX
DE   Human MHC class II antigen HLA-DRB1*1324 gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-265
RX   DOI; 10.1111/j.1399-0039.1997.tb02832.x.
RX   PUBMED; 9243754.
RA   Ellis J.M., Robbins F., Wang J., Tang T., Heine U., Mason J.M., Sese D.,
RA   Milford E., Hurley C.K.;
RT   "Identification of four new DR52-associated DRB1 alleles: DRB1*1424, *1425,
RT   *1323 and *1324";
RL   Tissue Antigens 50(1):42-46(1997).
XX
RN   [2]
RP   1-265
RA   Robbins F.-M.;
RT   ;
RL   Submitted (21-SEP-1995) to the INSDC.
RL   Pediatrics, Georgetown Univ. Med. School, 8901 Wisconsin Ave, Bethesda, MD
RL   20889, USA
XX
DR   MD5; 75a08a60fc26934712468d551f77829e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..265
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /cell_line="GN039"
FT                   /cell_type="BLCL"
FT                   /db_xref="taxon:9606"
FT   exon            1..265
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>265
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:24"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAC51628.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDFLEDERAAVDTYCRHNYGVVESFTVQR"
XX
SQ   Sequence 265 BP; 55 A; 63 C; 94 G; 53 T; 0 other;
     cgtttcttgg agtactctac gtctgagtgt catttcttca atgggacgga gcgggtgcgg        60
     ttcctggaca gatacttcta taaccaagag gagtacgtgc gcttcgacag cgacgtgggg       120
     gagttccggg cggtgacgga gctggggcgg cctgatgccg agtactggaa cagccagaag       180
     gacttcctgg aagacgagcg ggccgcggtg gacacctact gcagacacaa ctacggggtt       240
     gtggagagct tcacagtgca gcggc                                             265
//