Dbfetch

ID   U36760; SV 1; linear; mRNA; STD; MUS; 2934 BP.
XX
AC   U36760;
XX
DT   25-OCT-1995 (Rel. 45, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Mus musculus brain factor-1 (Hfhbf1) mRNA, class 2, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2934
RX   DOI; 10.1016/0169-328X(95)00276-X.
RX   PUBMED; 8738140.
RA   Li H., Tao W., Lai E.;
RT   "Characterization of the structure and function of the gene for
RT   transcription factor BF-1, an essential regulator of forebrain
RT   development";
RL   Brain Res. Mol. Brain Res. 37(1-2):96-104(1996).
XX
RN   [2]
RP   1-2934
RA   Li H., Tao W., Lai E.;
RT   ;
RL   Submitted (20-SEP-1995) to the INSDC.
RL   Eseng Lai, Cell Bio & Genetics, Sloan Kettering Inst, 1275 York Avenue, New
RL   York, NY 10021, USA
XX
DR   MD5; a4a56d7c03cc4a3fb7129f69e63eba31.
DR   Ensembl-Gn; ENSMUSG00000020950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179669; mus_musculus.
DR   EuropePMC; PMC187570; 12466304.
DR   EuropePMC; PMC27144; 11005875.
DR   EuropePMC; PMC312756; 11511541.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2934
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             566..2011
FT                   /codon_start=1
FT                   /gene="Hfhbf1"
FT                   /product="brain factor-1"
FT                   /note="BF-1; winged-helix transcription factor"
FT                   /db_xref="GOA:Q60987"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:1347464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60987"
FT                   /protein_id="AAB42158.1"
FT                   /translation="MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHP
FT                   QHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPP
FT                   STALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKE
FT                   GDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIR
FT                   HNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRG
FT                   ARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQN
FT                   SLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSV
FT                   NLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTG
FT                   LSGGLSDYFTHQNQGSSSNPLIH"
XX
SQ   Sequence 2934 BP; 668 A; 914 C; 737 G; 615 T; 0 other;
     aaaaaacgga agtagacgcc cactcatatt ttcttcaatg tcaagcaaaa tgaaaatatt        60
     tccaggatga tcgatcgcgg ctaccggctt ccagtactgc ctagaagctg aagaggaggt       120
     ggagtgcccg aggagacaac tgccaccggg tcacccgcgc gtgagcgcga ctctgggagt       180
     gaagcgagac ggagggagaa cacacgtgtt acctgcttta tttcgggact gtttgggtct       240
     gtgctccccc ggggcagctc tccgcccgcc cgcccgcgtg cgtggaaggc ctccacagaa       300
     cgcacccacc gctcagccgc ccccgctcgc cgccctcagc ccagcttcac agccgagctc       360
     gccgcgggcc gcaggaagct cttttgctac atgccttgcc agcgccggag cctgcggtcc       420
     aactgcgctg ctgccggagc gctcagtgcc gcctccgctg cccgctcccc ccgcgcccca       480
     ctccgaaccc gctggtcgcc cgccgcgctg ctgcccccct cccgtgccgc cgccgccgcc       540
     gccgccgccc cccgacgcct gggtgatgct ggacatggga gataggaaag aggtgaaaat       600
     gattcccaag tcctcgttca gcatcaacag cctggtcccc gaggccgtcc agaacgacaa       660
     ccaccacgcg agccacggcc accacaacag ccaccacccc cagcatcacc atcatcatca       720
     ccaccaccac cacccgccgc cgcccgcgcc ccagccgcct ccaccgccgc cccagcagca       780
     gcagcagcag ccgccccccg ccccgcagcc cccgcaggcg cgcggcgccc cagcagccga       840
     cgacgacaag ggtccccagc cgctcctgct cccgccctcc accgccctgg acggggccaa       900
     ggctgacgca cttggagcca aaggcgagcc gggcggcggg ccggcggagc tggcgcccgt       960
     cgggccggac gagaaggaga agggcgcggg cgccgggggg gaggagaaga aaggggcggg      1020
     cgagggcggc aaggacgggg aggggggcaa ggagggcgac aagaagaacg gcaagtacga      1080
     gaagccgccg ttcagctaca acgcgctcat catgatggcc atcaggcaga gtcccgagaa      1140
     gcgcctgacg ctcaatggca tctatgagtt catcatgaag aacttcccct actaccgcga      1200
     gaacaagcag ggctggcaga actccatccg ccacaacctg tccctcaaca agtgcttcgt      1260
     gaaggtaccg cgccactacg acgacccggg caagggcaac tactggatgc tcgacccgtc      1320
     gagcgacgac gtgttcatcg gcggcacgac cggcaagctg cggcgccgct ccaccacgtc      1380
     tcgggccaag ctggccttta agcgcggggc gcgcctcacc tccaccggcc tcaccttcat      1440
     ggaccgcgcc ggctccctct actggcccat gtcgcccttc ctgtccctgc accacccccg      1500
     cgccagcagc actttgagtt acaacgggac cacgtcggcc taccccagcc accccatgcc      1560
     ctacagctcc gtgttgactc aaaactcgct gggcaacaac cactccttct ccaccgccaa      1620
     cgggctgagt gtggaccggc tggtcaacgg ggagatcccg tacgccacgc accacctcac      1680
     ggccgctgcg ctcgccgcct cggtgccctg cggcctgtcg gtgccctgct ccgggaccta      1740
     ctccctcaac ccctgctccg tcaacctgct cgcgggccag accagttact ttttccccca      1800
     cgtcccgcac ccgtcaatga cttcgcagac cagcacgtcc atgagcgccc gggccgcgtc      1860
     ctcctctacg tcgccgcagg ccccctcgac cctgccctgt gagtctttaa gaccctcttt      1920
     gccaagtttt acgacaggac tgtccggggg actgtctgat tatttcacac atcaaaatca      1980
     ggggtcttct tccaaccctt taatacatta acatccgggg gaccagactg taagtgaacg      2040
     ttttacacac atttgcattg taaatgataa ttaaaaaaat aagtccaggg attttttatt      2100
     aagccccccc tccccatttc tgtacgtttg ttcagtcttt agggtcgttt actattctaa      2160
     cacggtgtgg agtgtcagcg aggtgcaatg tgggagaata cattgtagaa tataaggttt      2220
     ggacgtcaaa ttatagtaga atgtgtatct aaatagtgac tgctttgcca tttcattcaa      2280
     acctgacaag tctatctcaa caggctgcca gatttccatg tgtgcagtat tataagttat      2340
     catggagcta tctggtggac gcaggccttg agaacaacct aaattatgaa gagagtttta      2400
     aaatgttaaa ttgtaatttg tatttaagaa tttgtagtaa aggtgcccaa ggaattatat      2460
     tggccattta ttgttttgtc cttttcttta aagaactgtt tctttccttt tgtttacttt      2520
     tagaccaaag attggattct agcaaatgca cttggtatac taagtattaa aacaagtaaa      2580
     caaacaaacg aaaaaggaag gttgtttagt tggcaacact gcccattcaa ttgaatccga      2640
     aaggacaaaa ttaaggattg ccttcagttt gtgttgtgta tatttcgatg tatgtggtca      2700
     ctaacaggtc acttttattt tttctaaatg tagtgaaatg ttaataccta ttgtacttat      2760
     aggtaaacct tgcaaatatg taacctgtgt tgcgcaaatg ccgcatcaat ttgagtgatt      2820
     gttaatgttg tcttaaaatt tcttgattgt gatactgtgg tcatatgccc gtgtttgtca      2880
     cttacaaaaa tgtttactat gaacacacag aaataaaaaa taggctaaat tcat            2934
//