spacer

EBI Dbfetch

ID   U35885; SV 1; linear; mRNA; STD; MUS; 1347 BP.
XX
AC   U35885;
XX
DT   05-OCT-1995 (Rel. 45, Created)
DT   20-JAN-2000 (Rel. 62, Last updated, Version 2)
XX
DE   Mus musculus N-acetyltransferase NAT-1 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1347
RX   PUBMED; 1875909.
RA   Martell K.J., Vatsis K.P., Weber W.W.;
RT   "Molecular genetic basis of rapid and slow acetylation in mice";
RL   Mol. Pharmacol. 40(2):218-227(1991).
XX
RN   [2]
RP   1-1347
RX   PUBMED; 10640510.
RA   Estrada L., Kanelakis K.C., Levy G.N., Weber W.W.;
RT   "Tissue- and gender-specific expression of N-acetyltransferase 2 (Nat2*)
RT   during development of the outbred mouse strain CD-1";
RL   Drug Metab. Dispos. 28(2):139-146(2000).
XX
RN   [3]
RP   1-1347
RA   Martell K.J.;
RT   ;
RL   Submitted (12-SEP-1995) to the INSDC.
RL   Karen J. Martell, Pharmacology, University of Michigan, 1301 Catherine
RL   Street, Ann Arbor, MI 48109, USA
XX
DR   MD5; 38f0643d1cf72ebe2314c0661827a499.
DR   Ensembl-Gn; ENSMUSG00000025588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026677; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1347
FT                   /organism="Mus musculus"
FT                   /strain="C57Bl6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             217..1089
FT                   /codon_start=1
FT                   /product="N-acetyltransferase NAT-1"
FT                   /db_xref="GOA:P50294"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="MGI:MGI:97279"
FT                   /db_xref="UniProtKB/Swiss-Prot:P50294"
FT                   /protein_id="AAA78942.1"
FT                   /translation="MDIEAYFERIGYKNSVNKLDLATLTEVLQHQMRAVPFENLNMHCG
FT                   EAMHLDLQDIFDHIVRKKRGGWCLQVNHLLYWALTKMGFETTMLGGYVYITPVSKYSSE
FT                   MVHLLVQVTISDRKYIVDSAYGGSYQMWEPLELTSGKDQPQVPAIFLLTEENGTWYLDQ
FT                   IRREQYVPNEEFVNSDLLEKNKYRKIYSFTLEPRVIEDFEYVNSYLQTSPASVFVSTSF
FT                   CSLQTSEGVHCLVGSTFTSRRFSYKDDVDLVEFKYVNEEEIEDVLKTAFGISLERKFVP
FT                   KHGELVFTI"
XX
SQ   Sequence 1347 BP; 420 A; 249 C; 281 G; 397 T; 0 other;
     caaaactttc ctttaagggg cacagagatt atttaatgaa ctgtaggtaa aaacaagcca        60
     tgcagtcaaa gtgatatgat tgcctatgag atagttagag gcatttttat gtatacgtgt       120
     taacagtaga ttctagctac agatagctga ctctgggaca cctacaagaa ttgttgtaat       180
     gtttgtctgc tttcattctg tttgccttag gggaccatgg acatcgaagc atactttgaa       240
     aggattggtt acaagaactc agtgaataaa ttggacttag ccacattaac tgaagttctt       300
     cagcaccaga tgcgagcagt tccttttgag aatcttaaca tgcattgtgg agaagccatg       360
     catctggatt tacaggacat ttttgaccac atagtaagga agaagagagg tggatggtgt       420
     ctccaggtta atcatctgct gtactgggct ctgaccaaaa tgggctttga aaccacaatg       480
     ttgggaggat atgtttacat aactccagtc agcaaatata gcagtgaaat ggtccacctt       540
     ctagtacagg tgaccatcag tgacaggaag tacattgtgg attccgccta tggaggctcc       600
     taccagatgt gggagcctct ggaattaaca tctgggaagg atcagcctca ggtgcctgcc       660
     atcttccttt tgacagagga gaatggaacc tggtacttgg accaaatcag aagagagcag       720
     tatgttccaa atgaagaatt tgttaactca gacctccttg aaaagaacaa atatcgaaaa       780
     atctactcct ttactcttga gccccgagtt atcgaggatt ttgaatatgt gaatagctat       840
     cttcagacat cgccagcatc tgtgtttgta agcacatcgt tctgttcctt gcagacctcg       900
     gaaggggttc actgtttagt gggctccacc tttacaagta ggagattcag ctataaggac       960
     gatgtagatc tggttgagtt taaatatgtg aatgaggaag aaatagaaga tgtactgaaa      1020
     accgcatttg gcatttcttt ggagagaaag tttgtgccca aacatggtga actagttttt      1080
     actatttagg gtaaggagca aaattgttct ccattgttat ttcatagtct taaaccttct      1140
     aaacatatgc aaatgtatcc ataacagaaa tcacccagtc caatgctgac caactaatga      1200
     cttgttgtat cttctatttc ctagatttta taaaacgaaa tcctactcct cctgtcattt      1260
     caccaataaa aatagcgtca gttatacttg aataaaataa atatattaat ggatgtaaca      1320
     acaatccttt caatattaat caacaaa                                          1347
//


spacer
spacer