Dbfetch

ID   U35729; SV 1; linear; mRNA; STD; HUM; 306 BP.
XX
AC   U35729;
XX
DT   11-OCT-1995 (Rel. 45, Created)
DT   17-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Human MHC class II HLA-DR-beta (HLA-DRB1-03011 allele) mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-306
RA   Hurley C.K.;
RT   ;
RL   Submitted (08-SEP-1995) to the INSDC.
RL   Carolyn K. Hurley, Microbiology and Immunology, Georgetown, University
RL   School of Medicine, 3970 Reservior Road NW, Washington, DC 20007, USA
XX
DR   MD5; a8b8518d30c4edf94d360d0504588687.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..306
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="mRNA"
FT                   /haplotype="DRB1-03011, DRB1-03022; DRB3-0101,02;
FT                   DQB1-0201,0301"
FT                   /cell_type="B-lymphocyte"
FT                   /tissue_type="blood"
FT                   /germline
FT                   /db_xref="taxon:9606"
FT   gene            1..306
FT                   /gene="HLA-DRB1"
FT   CDS             <1..>306
FT                   /codon_start=1
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II HLA-DR-beta"
FT                   /note="HLA-DRB1-03011 allele"
FT                   /db_xref="GOA:O19190"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:O19190"
FT                   /protein_id="AAA79144.1"
FT                   /translation="GDTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVG
FT                   EFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVY"
FT   exon            1..13
FT                   /gene="HLA-DRB1"
FT   exon            14..282
FT                   /gene="HLA-DRB1"
FT   exon            283..306
FT                   /gene="HLA-DRB1"
XX
SQ   Sequence 306 BP; 68 A; 73 C; 108 G; 57 T; 0 other;
     ggggacacca gaccacgttt cttggagtac tctacgtctg agtgtcattt cttcaatggg        60
     acggagcggg tgcggtacct ggacagatac ttccataacc aggaggagaa cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga tgccgagtac       180
     tggaacagcc agaaggacct cctggagcag aagcggggcc gggtggacaa ctactgcaga       240
     cacaactacg gggttgtgga gagcttcaca gtgcagcggc gagtccatcc taaggtgact       300
     gtgtat                                                                  306
//