Dbfetch

ID   AH006745; SV 2; linear; genomic DNA; STD; MUS; 9308 BP.
XX
AC   AH006745; U32925-U32935;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus opioid receptor (KOR-3) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2008,2474-2931,3389-5816
RX   DOI; 10.1016/0378-1119(95)00890-X.
RX   PUBMED; 8666282.
RA   Pan Y.X., Xu J., Pasternak G.W.;
RT   "Structure and characterization of the gene encoding a mouse kappa3-related
RT   opioid receptor";
RL   Gene 171(2):255-260(1996).
XX
RN   [2]
RP   2109-2373,3032-3288,5917-6272,6373-6453,6554-7108,7209-7326,7427-8591,
RP   8692-9308
RA   Pan Y.-X., Xu J., Pasternak G.W.;
RT   "Structure and characterization of the gene encoding a mouse kappa3-related
RT   opioid receptor";
RL   Unpublished.
XX
RN   [3]
RP   1-9308
RA   Pan Y.-X.;
RT   ;
RL   Submitted (01-AUG-1995) to the INSDC.
RL   Ying-Xian Pan, Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York
RL   Avenue, New York, NY 10021, USA
XX
DR   MD5; 9f805e7861412a76c8875f37a6be3533.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:1464779, gi:1464780, gi:1464781, gi:1464782, gi:1464783,
CC   gi:1464784, gi:1464785, gi:1464786, gi:1464787, gi:1464788,
CC   gi:1464789, gi:1464790.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..9308
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   misc_feature    1..2008
FT                   /note="5' flanking region"
FT   gap             2009..2108
FT                   /estimated_length=unknown
FT   gene            2109..8591
FT                   /gene="KOR-3"
FT   mRNA            join(2109..2373,3032..3288,5917..6272,6554..7108,
FT                   7427..8591)
FT                   /gene="KOR-3"
FT                   /product="opioid receptor"
FT   exon            2109..2373
FT                   /gene="KOR-3"
FT                   /number=1
FT   gap             2374..2473
FT                   /estimated_length=unknown
FT   intron          2474..2931
FT                   /gene="KOR-3"
FT                   /number=1
FT   gap             2932..3031
FT                   /estimated_length=unknown
FT   exon            3032..3288
FT                   /gene="KOR-3"
FT                   /number=2
FT   CDS             join(3065..3288,5917..6272,6554..7077)
FT                   /codon_start=1
FT                   /gene="KOR-3"
FT                   /product="opioid receptor"
FT                   /protein_id="AAC52669.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   gap             3289..3388
FT                   /estimated_length=unknown
FT   intron          3389..5816
FT                   /gene="KOR-3"
FT                   /number=2
FT   gap             5817..5916
FT                   /estimated_length=unknown
FT   exon            5917..6272
FT                   /gene="KOR-3"
FT                   /number=3
FT   gap             6273..6372
FT                   /estimated_length=unknown
FT   intron          6373..6453
FT                   /gene="KOR-3"
FT                   /number=3
FT   gap             6454..6553
FT                   /estimated_length=unknown
FT   exon            6554..7108
FT                   /gene="KOR-3"
FT                   /number=4
FT   gap             7109..7208
FT                   /estimated_length=unknown
FT   intron          7209..7326
FT                   /gene="KOR-3"
FT                   /number=4
FT   gap             7327..7426
FT                   /estimated_length=unknown
FT   exon            7427..8591
FT                   /gene="KOR-3"
FT                   /number=5
FT   gap             8592..8691
FT                   /estimated_length=unknown
FT   misc_feature    8692..9308
FT                   /note="3' flanking region"
XX
SQ   Sequence 9308 BP; 1919 A; 1898 C; 2050 G; 2441 T; 1000 other;
     ggcgtcgact cgatcaagat gcttgagctg tttcctctgg accaccagtg ccccattgtg        60
     gccgagtcac ctgtcagata accaaattat tcttccatct gagacagcat ttgagcatgt       120
     ggactctgag ctacattcta ttggtacaca actccagata tatgttgaga ccagagctca       180
     gtcttacttg gcagcattgt agctgattca tagttgaggc cataatgcta agccaagaac       240
     tcctgggact gaggcagtgg cagggaaagc ttcttaggct aggtcagagt agagctggtt       300
     tgggtacggg atccatgcag tggggcaagg tgaagcacac aggacccaac tcaaggtcat       360
     gagacgaagg gacattctgt ggctctgttc tgcctatatt taaacaatgc ttatggcacc       420
     ctctttctaa atctggaacc tgggctggaa agcaggtaaa gactattagg aaaagaggct       480
     ctgtagaggc acagagacaa cttggttgat aactctgagg ttgtgtgcca gctttgcctg       540
     gagtgggagg gaagagggag agagagagag agagacagag acagagacag taacagagag       600
     tgcataccta tgtactatat atctaggggc cttgctctgt gcctgcctgt ttccacacta       660
     gtttacatcc tgtttgtatc tttctctttg tgcctgcatt cactttgtga gttttgtata       720
     tgtgattctt gggtgcacct ctgagcacat atcccttgtg tctctgtgtc tctatactgc       780
     gcctgtctgg gtatctctgt gtatgttctg tttatttgca ggaatgtgtc ctcatgtgtc       840
     tccttgagtg tccatgtgtc cctgagaatg gagagacaag tccttggaga cagcttggga       900
     tgctgagtcc tggggtgtct gtctgctctg gccttttctg gttggacagg tatcctagca       960
     acacttctgt gagttgccta gcaaccaggt ccccatcctt agagaaagag cagggtctgg      1020
     ctgtatgtgg gagatctggc tctcattcag tacagacagc aaaagcaagc ctatgatttg      1080
     atgatggcta gagactcagc atagggtctc tagcctacat gaccttaact tacggctttt      1140
     tttctcagtg gactgtgacc ccttgtgctg gcaaagaaag aggagcttag tatctctgtg      1200
     ttttctaaga tctaattctg ggagttagct gtggtgtagc tccaagtgac cagcagacct      1260
     ggctttcctt taccatgaca tattgacagg cagcttcaga cttcagagac atgatgcttt      1320
     catttgtgag gataatatgg gtggtaatgg ctacatgcag tgggggttcc tgggttcagt      1380
     tttgtcttgg gcttagtgta cattaggtat aagcagcaca taatagattc agggcagtat      1440
     ttggtcctta gtccagacaa tctcttgctt acttgcaaga aagcctttcc atggagaatt      1500
     agttgggtta gggtattgct gtctattact gtggtactct gctttactgg acagttctgg      1560
     gcaggaaagc tggcaaaata tggtctgggc taagctggac aaaacaacat ttaccagtga      1620
     tggtggtgca cgccttaatc ccagcactca gaaagcagag gcagacatat ctttgagttc      1680
     caggacagcc aaggctacac agagaaatcc tgtctctaac ccatcacccc tccaacaaaa      1740
     caaaacaaaa caaaacaaaa caaaacaaaa caaaacaaaa caaaacaaaa cagaacaaaa      1800
     cattttcctc acatctgcct ctaggtgagc atttctctgt atacatctta agtgtgttct      1860
     tgtgtctaag gctgtgcatg tatgtgtgtc tgagttccta ttcatgtctc catttttgtg      1920
     tttatagatg tctccactgt gtgtcccaga tcctgagtgt gtctgtcttg tgtgtcttgt      1980
     gtgagccgat tttttttttt ttttttttnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnntt tggcttcctt ctccaacctg cgcagcccct ccttctctca gccgcagcct      2160
     tctgcccctc ccccttctgg ctgccgcact ggctgctgcg tctagtcaat atcttatctt      2220
     cggagcagga gctaggagcc attcccagcc ggagcagacc ccaagctaga gtgagaagca      2280
     ttactcagtt cattgtgctc ctgcctgcct ttctgctaag cattagggtc tgttttggcc      2340
     cagcttctga agaggttgtg tgtgctgttg gagnnnnnnn nnnnnnnnnn nnnnnnnnnn      2400
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnngtaagag gggctctagt gagggctcct gctgctgctg acagagctgg      2520
     gggtggggga gcactgggag gtagggaagt gcctgagccc taggatttct gggtaaattc      2580
     catgtctttt gtgctccagt gtgccttagg atggtttggg catttttttg tattcggctg      2640
     actgtgagcc cctgagtctc ggtgggtgga catgtatgct tgtgtagcta cctccatgtt      2700
     gcttctgtgc gagtctatca ccctaatatg aggtaaaatt gtgagtaaat gtgcccccat      2760
     gcctctgtgt gtgtcatcat gtgcccatgt gtatgccttt gtctgtgtcc atgtgtctgt      2820
     gtgtggatgc ccatcgaggt gttcatgtgc ctgttagtgt agttgtgctg ttctaaggcc      2880
     tcagtggact gtgtccagca ctgtggtcac ttctttctgt gtctgttcca gnnnnnnnnn      2940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3000
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ngaactgtac tgagtggctt tgcagggtga      3060
     cagcatggag tccctctttc ctgccccatt ctgggaggtc ttgtatggca gccactttca      3120
     agggaacctg tctctcctaa atgagaccgt accccatcac ctgctcctca atgctagcca      3180
     cagtgccttc ctgccccttg gactcaaggt caccatcgtg gggctctact tggctgtgtg      3240
     catcgggggg ctcctgggga actgcctcgt catgtatgtc atcctcagnn nnnnnnnnnn      3300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnngt aggcgggtcc catcaatctg tgaaggggga      3420
     actgaggcag gaggctgttc tggatgaatt cgaacaagca tggattttct gcttgctcca      3480
     tcaaatttct tccctctctg ttcaagggac atgatcaccc ttgaagttca actcctgttc      3540
     tgctcccatc tgtctcagac taggtgtcac cacctggagg cttggtactg cagataaatc      3600
     catgccgtga tgtctactga ctgaataacc atgggtacaa aggatcctaa gatttcccaa      3660
     agagaggaag aggggctggt gctgggcctg aagcttgttc attggccttt aggatctctg      3720
     ctcatggtgg atgtctttag ctgagcccat gctctattgg tgctcagaaa tgggaaaatt      3780
     tggaggacta caaagaaaga cagcagtact ggatgactga ggtagcgtcg acggtgaggg      3840
     gaagagggca gtgtgaggta cagttctatg gacaagaaag ctgggcaagg agtatgcaat      3900
     tggtaaatgt gtggtggcaa tgatggtctc tgtttttttc cagctgggag ggcattgagg      3960
     ggaactggag acagcaggtg aggacttgaa tgccagaatg ggacgccaaa ttgctttgga      4020
     cattgggaag acatgggagg tccttgagtg gtggataact agagcaaggt tcttcactga      4080
     tatttccgtc tttcaaaaag atgactctga agagagcagt catggttccc ttgatggtat      4140
     catggtaggt gtggtattgg tagaggagga aggggcagta cagtgtccat accctgcctc      4200
     attatggtcc tcttagtatt tctgagcaac tgttttctct gtttgttaga tgggaaatgt      4260
     ggattatata gtcatatata ggtgcatgtg ccaagacgtg tgtatatata tatatgctat      4320
     gtgattggaa aagcattcca agtattgact tttggcagag gacccttgtg ggaaactatt      4380
     ctatgatcca tgtgtctcat ggttaaaagg atatgtcttt ggcaagacgt gcagcaacca      4440
     gggacagttt gtgagccttg cctttccttc gcatcagcat ttccctccta tattgtcctc      4500
     tgcatttggg atattaaaat tcttgagcca tttactgcag tagagtagag aaggaacgcc      4560
     atcttttcca ccagcatccc cagagaacta gtctcagaaa ctgctgtggc tgcactggct      4620
     caggagacaa cacacggcat gtttgagttg gatgtgtgcc aggagtcaga aaaatatgct      4680
     ctgagcccca ttttgcacct tagcagttct aagccttatg aaagctactt agttcctctg      4740
     agtctcagct tccttctcca cagcgtagga gattaaatgg catttttgct ttggggtaaa      4800
     cctcaaatga gataaaatct atgtgaagag cttggctcag atatctacca ttatcattaa      4860
     cattgttatt tattgtaatt aaggtctctg ggattaatgt ctaagagaca gaacttaact      4920
     cagattccct ggtagcaact aaacatcatg gactacgtta tctctagtgc taccaccacc      4980
     atactgccat aaccaccata accactataa ccaccaccat taccaccatc actttcatca      5040
     tcatcactat agtcaccctt ccctaccact gtcataaaca ttaattcatt cactaatatt      5100
     ataacttata tgttcctagc atggttccca gcgcttggat acatcaaacc taactagcac      5160
     atctcctttt ttctttatta gaataaaaaa tattgtgttt atttttgggt atgacgtgtt      5220
     tctgctggat gtataggtca gatgagaaag cttggctttc tccttttact atgtaagttt      5280
     ctccttctac cacatgtgtc ctggaaatgg aactcaggtc atcagaattg gtaataagtg      5340
     cccttaccag ctgagccatt tgctggacca ccattttctg ttttcattgc tagacaacat      5400
     tgtgcacttg gaagatcttt gatgaacttt acaggcagtg ccctgaaaac cctctgagag      5460
     gagtcttaag agagactgag gagagaagac agcatctctc tctcttgatt ccttccacaa      5520
     attcacattc aggttagata tgtactcacg gtactcttcc atgcccccaa cttttccagg      5580
     atagtcctgt catagaattg gaaccttttt gtagatgtca taatcacatg ggggagcttg      5640
     ttaaagtcct aggctcagtg gaccttgggt gtagtgcagg atctgccatt taataagctt      5700
     ctttggagac tctggggttg agagattcaa agatgatgac cctcttggtg gtctttttgc      5760
     ggccaagtct agacaaaatg gccaaatgga gtgtttcttc tccttgtcct ctacagnnnn      5820
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5880
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngcac accaagatga agactgctac      5940
     caacatttac atatttaatc tggcactggc tgataccctg gtcttgctga cactgccctt      6000
     ccagggcaca gacatccttc tgggcttctg gccatttggg aatgcactgt gcaagacggt      6060
     cattgctatc gactactaca acatgtttac cagcactttc actttgactg ccatgagtgt      6120
     agaccgttat gtagctatct gccaccctat ccgtgccctt gatgttcgga catccagtaa      6180
     agcccaggcc gttaatgtgg ccatatgggc cctggcttcg gtggttggtg ttcctgttgc      6240
     catcatgggc tcagcacaag tggaggatga agnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6360
     nnnnnnnnnn nngtcagtgg gcagtcctcc tccctgacca atcagttccc catggttctt      6420
     gccggcccct ctgacctcat ttctctcctg cagnnnnnnn nnnnnnnnnn nnnnnnnnnn      6480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6540
     nnnnnnnnnn nnnagatcga gtgcctggtg gagatccccg cccctcagga ctattggggc      6600
     cctgtatttg ccatctgcat cttccttttt tccttcatca tcccggttct gatcatctct      6660
     gtctgctaca gcctcatgat tcgacgactt cgtggtgtcc ggctgctttc aggctcccga      6720
     gagaaggacc ggaacctgcg acgcatcaca cggctggtac tggtagttgt ggctgtgttt      6780
     gtgggctgct ggacacctgt gcaggtcttt gtcctggttc aaggactggg tgttcagcca      6840
     ggtagtgaga ctgcagtagc cattctgcgc ttctgcacag ccctgggcta tgtcaacagt      6900
     tgtctcaatc ccattctcta tgctttcttg gatgagaact tcaaggcctg ctttagaaag      6960
     ttctgctgtg cttctgccct gcaccgggag atgcaggttt ctgatcgtgt gcgcagcatt      7020
     gccaaggatg taggccttgg ttgcaagacc tctgagacag taccacggcc ggcatgacta      7080
     ggcgtggacc tgcccatggt gcctgtcann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7200
     nnnnnnnngt ccacagagcc catctacacc caacacggag ctcacacagg tcactgctct      7260
     ctaggttgac cctgaactga gcgtctgggg ccttgaatgg cttttctttt ggttcaggat      7320
     gctcagnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngtcc tagaggaaga      7440
     ccttttagca ccatgggaca ggtcaaagca tcaaggtggc ctccatggct ctgtcagatt      7500
     aagtttcctc cctggtatag gaccagagag aaccaaagga actgcatgga aacatccaca      7560
     actcagtgga catgcctggt gaacccatgt aggtattcat ggttcacttg actcttctct      7620
     ggtttctccc tgctgccctg gttctaggtg ggctcagctg aggtattgta gttgtcatgt      7680
     agtcactatt gtgactacct gttgtgtgct attgccctca gccttcagtg tttgcacaga      7740
     actggtgatc atacccagtg ttgcctggcc cttaagcttg gagttgcctt ggagcatcta      7800
     gttctgactc cactgatgca ttcagattac ctgaggtggg tgagcatcag tgggttcttg      7860
     gatgactgtt tcctgacgat tcttttcatg ctgtactatg gtgtatatga aggggacttc      7920
     acacttcatc tggtactgcc actgcctgct ctaccaacct ggaccacctt ctcagcaaga      7980
     ggctagcagg gggacaagac acaaagcttc cctaaggctc tttccctcca aaaccactgt      8040
     gaactcttat tctacagact gtttggcaag ccctgcttct aactgtgtgg gaagtaatca      8100
     ggagaaaatt ctgtggcctc tgtaggctgc tcacagcatg gaggcaccac atgctggtct      8160
     tgggtatgtg tcttggctgc tcagtatggg cagggcaggg cacgagacta tctctctcct      8220
     tattctccac agcctccctc agctctccag cagtcgctct tttacttgac agtagaggtt      8280
     agcagcagtt gtactcgtag aaacacactt gtagcccggg aagactggag tcaggatgtg      8340
     ttctattcta tacccacagt gaccacctgc ttcatttata gggttaggac atatccaagc      8400
     aaggcctggg cttggcatca aatgaagagc tggtatgaga gctgaagcct aaaatggctc      8460
     atttgagcaa tctgcaagga ctattacggt tttggggaca ttggaagaag agtcgatacc      8520
     ttggagatat attgttggtt cacagaagaa gaggctttgt aaatgccctt tctatgggtc      8580
     agataaaaaa annnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8640
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ntaccagcaa      8700
     ccttggatag aatctgatct tacacagaga ccttggttag gtggtttcat gccatgcaga      8760
     acccaggctg gttcctgtct cagagagacc tggccttaac aatctttctg gggagaccag      8820
     ggttctttca atgacacttg tgcaggagcc attagctcta gtgttttctt gctaatgcta      8880
     gaactttgtg aatttgtata tctttatgta tttaagcatg caacaaatgt cattttcgtg      8940
     catgtagcta gccctgaacc tgcctctggg gtaatgaagg agttctcata ataaacactt      9000
     accagtgacc agtactgcct gtagaataag tctttctgat tccagctaca taagagtaac      9060
     ttcctgggta ttgatatgca ctggaatgag gcataggact aggctaaggg ttttaaaacc      9120
     tgttctgccc ttgcgaggga ctttaaggag cctcttggtt tatgggaggg aaactatttc      9180
     ctgggttgca gaggctgctg ctttccttct ccaagacaat gaccatcttt tcttcccacc      9240
     ctcaggacag tgggtaaatg ccttcacagc ttttctttgt agactctttc cttttgagca      9300
     aatctaaa                                                               9308
//