spacer

EBI Dbfetch

ID   U32932; SV 1; linear; genomic DNA; STD; MUS; 555 BP.
XX
AC   U32932;
XX
DT   28-JUL-1996 (Rel. 48, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus opioid receptor (KOR-3) gene, exon 4, and complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-555
RA   Pan Y.-X., Xu J., Pasternak G.W.;
RT   "Structure and characterization of the gene encoding a mouse kappa3-related
RT   opioid receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-555
RA   Pan Y.-X.;
RT   ;
RL   Submitted (01-AUG-1995) to the INSDC.
RL   Ying-Xian Pan, Neurology, Memorial Sloan-Kettering Cancer Center, 1275 York
RL   Avenue, New York, NY 10021, USA
XX
DR   MD5; b4d46f8e00dafbb11b30a392159828be.
DR   Ensembl-Gn; ENSMUSG00000027584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071585; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108766; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108768; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..555
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   CDS             join(U32928.1:34..257,U32930.1:1..356,1..524)
FT                   /codon_start=1
FT                   /gene="KOR-3"
FT                   /product="opioid receptor"
FT                   /db_xref="GOA:P35377"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001418"
FT                   /db_xref="InterPro:IPR001420"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:97440"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35377"
FT                   /protein_id="AAC52669.1"
FT                   /translation="MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPL
FT                   GLKVTIVGLYLAVCIGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQ
FT                   GTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSK
FT                   AQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFI
FT                   IPVLIISVCYSLMIRRLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVL
FT                   VQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREM
FT                   QVSDRVRSIAKDVGLGCKTSETVPRPA"
FT   exon            1..555
FT                   /gene="KOR-3"
FT                   /number=4
XX
SQ   Sequence 555 BP; 94 A; 151 C; 154 G; 156 T; 0 other;
     agatcgagtg cctggtggag atccccgccc ctcaggacta ttggggccct gtatttgcca        60
     tctgcatctt ccttttttcc ttcatcatcc cggttctgat catctctgtc tgctacagcc       120
     tcatgattcg acgacttcgt ggtgtccggc tgctttcagg ctcccgagag aaggaccgga       180
     acctgcgacg catcacacgg ctggtactgg tagttgtggc tgtgtttgtg ggctgctgga       240
     cacctgtgca ggtctttgtc ctggttcaag gactgggtgt tcagccaggt agtgagactg       300
     cagtagccat tctgcgcttc tgcacagccc tgggctatgt caacagttgt ctcaatccca       360
     ttctctatgc tttcttggat gagaacttca aggcctgctt tagaaagttc tgctgtgctt       420
     ctgccctgca ccgggagatg caggtttctg atcgtgtgcg cagcattgcc aaggatgtag       480
     gccttggttg caagacctct gagacagtac cacggccggc atgactaggc gtggacctgc       540
     ccatggtgcc tgtca                                                        555
//


spacer
spacer