spacer

EBI Dbfetch

ID   U30602; SV 1; linear; mRNA; STD; MUS; 4488 BP.
XX
AC   U30602;
XX
DT   07-AUG-1995 (Rel. 44, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus adenylyl cyclase type 9 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4488
RX   DOI; 10.1074/jbc.271.23.13900.
RX   PUBMED; 8662814.
RA   Premont R.T., Matsuoka I., Mattei M.G., Pouille Y., Defer N., Hanoune J.;
RT   "Identification and characterization of a widely expressed form of adenylyl
RT   cyclase";
RL   J Biol Chem 271(23):13900-13907(1996).
XX
RN   [2]
RP   1-4488
RA   Premont R.T.;
RT   ;
RL   Submitted (29-JUN-1995) to the INSDC.
RL   Richard T. Premont, Department of Medicine, Duke University Medical Center,
RL   Durham, NC 27710, USA
XX
DR   MD5; b1f7fd2a3f32d59e57bbac05d763824d.
DR   Ensembl-Gn; ENSMUSG00000005580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005719; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117801; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4488
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             74..4135
FT                   /codon_start=1
FT                   /product="adenylyl cyclase type 9"
FT                   /db_xref="GOA:P51830"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:108450"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51830"
FT                   /protein_id="AAC52603.1"
FT                   /translation="MASSPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNTHPKH
FT                   CKYSISSSCSSSGDSGGLPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSMNLEEAC
FT                   LERCFPQTQRRFRYALFYVGFACLLWSIYFAVHMKSKVIVMVVPALCFLVVCVGFFLFT
FT                   FTKLYARHYAWTSLALTLLVFALTLAAQFQVWTPLSGRVDSSNHTLTATPADTCLSQVG
FT                   SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGALHWEL
FT                   LSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPR
FT                   IIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFAD
FT                   IVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADH
FT                   AYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLA
FT                   NLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQLKGLKTYLISGQRA
FT                   KESHCSCAEALLSGFEVIDDSRESSGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCGI
FT                   TFAPKSEAGAEGGTVQNGCQDEPKTSTKASGGPNSKTQNGLLSPPAEEKLTNSQTSLCE
FT                   ILQEKGRWAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLN
FT                   FLDQELERSYRTSYQEEVIKNSPVKTFASATFSSLLDVFLSTTVFLILSITCFLKYGAT
FT                   ATPPPPAALAVFGADLLLEVLSLIVSIRMVFFLEDVMTCTKWLLEWIAGWLPRHCIGAI
FT                   LVSLPALAVYSHITSEFETNIHVTMFTGSAVLVAVVHYCNFCQLSSWMRSSLATIVGAG
FT                   LLLLLHISLCQDSSIVMSPLDSAQNFSAQRNPCNSSVLQDGRRPASLIGKELILTFFLL
FT                   LLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQ
FT                   TYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKI
FT                   KTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVG
FT                   FNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDY
FT                   RGTVNVKGKGQMKTYLYPKCTDNGVVPQHQLSISPDIRVQVDGSIGRSPTDEIANLVPS
FT                   VQYSDKASLGSDDSTQAKEARLSSKRSWREPVKAEERFPFGKAIEKDSCEDIGVEEASE
FT                   LSKLNVSKSV"
XX
SQ   Sequence 4488 BP; 1018 A; 1203 C; 1237 G; 1030 T; 0 other;
     ggccgcggca cgagaaccct gggagcacca ggtgccctga cctggtcggg aaaggttcca        60
     agagctcggc aacatggctt cctcacccca ccagcagctg ctgcatcacc atagcaccga       120
     ggtgagctgc gactcaagcg gagacagcaa cagcgtgagg gtcaagatca accctaagca       180
     gctgtcctcc aacacccacc cgaagcactg caagtacagc atctcctcca gctgtagcag       240
     ctcgggagac tcagggggcc ttccccggag ggttggcggc gggggtcgcc tgcgcagaca       300
     gaagaagctg ccccagcttt ttgagagggc ctccagccgg tggtgggacc ccaaattcga       360
     ctccatgaac ctggaggagg cctgcctgga gcgctgcttt ccgcagaccc agcgccgctt       420
     ccggtacgca ctcttttatg tgggcttcgc ctgccttctc tggagcatct atttcgctgt       480
     ccacatgaaa tccaaagtga ttgtcatggt ggtcccagct ctgtgcttcc tggtggtgtg       540
     tgtgggcttt ttcctgttta ctttcaccaa gctgtacgcc cggcattatg cgtggacctc       600
     gctggctctc accctgctgg tgttcgccct gaccctggct gcgcagtttc aggtttggac       660
     acctctgtca ggacgtgttg acagctccaa tcatactctc acggccactc cggcggacac       720
     ttgcttatct caagtaggaa gcttctccat atgcatcgaa gtgctccttt tgctctacac       780
     agtcatgcag ttacctctgt acctgagctt gtttttgggg gtggtctatt ctgtcctttt       840
     tgagaccttc ggctaccact tccgaaacga agactgctac ccttctccgg gccctggggc       900
     cctgcactgg gagctgctga gcagagccct gcttcacgtg tgcattcacg ctatcgggat       960
     ccatctgttt gtcatgtctc aggtgaggtc caggagcacc tttctcaagg tgggacaatc      1020
     cattatgcac ggcaaagatc tggaagtaga gaaagccctg aaagagagga tgattcattc      1080
     agtgatgcca agaatcatag ccgacgactt aatgaaacaa ggggacgagg agagtgagaa      1140
     ttccgtcaag aggcatgcca cctccagtcc caagaacagg aagaagaagt cctccataca      1200
     gaaggcaccg atagcattcc gcccctttaa gatgcagcag attgaagaag tcagtatttt      1260
     atttgcagac attgtgggtt tcaccaagat gagcgccaac aaatctgcgc atgccttggt      1320
     aggcctactc aatgacctgt tcggtcgctt tgaccgcctg tgtgagcaga ccaagtgtga      1380
     gaagatcagc actctggggg actgttatta ctgtgtggca gggtgtccgg agccccgggc      1440
     agaccatgcc tactgctgca ttgaaatggg cttaggcatg ataaaagcca tcgagcagtt      1500
     ctgccaggag aagaaagaga tggtgaacat gcgtgttggg gttcacacgg ggactgtcct      1560
     gtgtggcatc ctgggcatga ggaggtttaa atttgatgtg tggtccaacg atgtgaactt      1620
     ggctaatctc atggagcagc tgggagtggc tggcaaagtt cacatatctg aggccactgc      1680
     aaaatactta gacgacaggt atgaaatgga agatgggaga gttattgagc gccttgggca      1740
     gagtgtggtg gctgaccagt tgaaaggttt gaagacatac ctgatatcgg gtcagagagc      1800
     caaggagtcc cactgcagct gtgcagaggc cctgctttct ggctttgagg tcattgacga      1860
     ctcacgggag tcctcaggcc ctaggggaca ggggacagca tcgccaggga gtgtcagtga      1920
     tttggcgcag actgtcaaaa cctttgataa ccttaagact tgcccttctt gtggaatcac      1980
     atttgctccc aaatctgaag ctggtgcaga aggaggaact gtgcaaaatg gctgtcaaga      2040
     cgagcctaag accagcacca aggcttctgg aggacccaac tccaaaaccc agaatggact      2100
     tctgagccct cctgcagagg agaagctcac taacagccag acctccctct gtgagatcct      2160
     gcaagagaag ggacggtggg caggggtgag cttggaccag tcagccctcc tcccgctcag      2220
     gttcaagaac atccgtgaga aaactgatgc ccactttgtt gatgtcatca aagaagacag      2280
     cctgatgaaa gattatttct tcaagccgcc catcaatcag ttcagcctga acttcctgga      2340
     ccaggagctg gagcgatcat atagaaccag ctaccaggaa gaggtcataa agaattctcc      2400
     tgtgaagacg ttcgccagtg ccaccttcag ctcccttctg gatgtgtttc tgtcaaccac      2460
     cgtgttcttg attctctcca tcacctgctt cctaaagtat ggagccaccg ccacccctcc      2520
     cccaccggct gccctggccg tctttggtgc agacctgctg ctggaggtgc tttccctcat      2580
     agtgtccatc agaatggtgt ttttcctaga ggatgtcatg acatgcacaa agtggttgct      2640
     ggaatggatc gctggctggc tccctcgcca ctgcattggg gcaatcttgg tgtctcttcc      2700
     tgccctggct gtctattcac acatcacctc tgagtttgag accaacatac atgttaccat      2760
     gttcactggc tctgcggtgc tggtggccgt tgtgcactac tgtaacttct gccagctcag      2820
     ctcctggatg aggtcctccc ttgccaccat cgtgggggct gggctgctgc ttctgctcca      2880
     catctccctg tgtcaggaca gttccattgt gatgtccccc ttggactcag cacagaattt      2940
     cagtgcccag aggaacccat gcaacagctc agtgctgcag gacggcagga ggccggccag      3000
     cctcataggc aaggagctta tcctcacctt cttcctcctg ctcctcttgg tctggttcct      3060
     gaaccgggag ttcgaggtca gctaccggct gcactaccat ggggatgtgg aggccgacct      3120
     acaccgcacc aagatccaga gcatgagaga ccaggctgac tggctactgc ggaacatcat      3180
     cccctaccat gtggctgagc agctcaaggt ctctcagacc tactccaaga accatgacag      3240
     cgggggagtc atctttgcca gcattgtcaa cttcagtgaa ttctatgagg agaactatga      3300
     ggggggcaag gagtgctacc gtgtcctcaa cgagctgatc ggtgacttcg atgagctctt      3360
     gagcaagccg gactataata gcatcgagaa gatcaagacc atcggggcca catacatggc      3420
     agcctcaggg ctgaacacgg cccagtgtca ggagggtggc cacccacagg agcatctgcg      3480
     tatcctcttc gagttcgcca aggagatgat gcgcgtggtg gatgacttca acaacaatat      3540
     gttatggttc aacttcaagc tcagggtcgg ctttaaccac ggacccctca cagcaggtgt      3600
     cataggtacc accaagctgc tgtatgacat ctggggggac accgtcaaca tcgccagcag      3660
     gatggacacc actggtgtgg agtgccgtat ccaggtgagc gaagagagct accgtgtgct      3720
     gagcaagatg ggttatgact ttgactaccg agggaccgtg aatgtcaagg ggaaagggca      3780
     gatgaagacc tacctttacc caaagtgcac ggacaatgga gtggttcccc agcaccagct      3840
     gtccatctcc ccagacatcc gagtccaggt ggacggcagc attgggcggt ctcccacaga      3900
     tgagattgcc aacttggtgc cttccgttca gtattcggac aaggcttccc tgggatctga      3960
     tgatagcaca caggctaagg aagctcgcct gtcctctaag aggtcctgga gagagccagt      4020
     caaagcagag gaaaggtttc catttggcaa agccatagaa aaggacagct gtgaagacat      4080
     aggagtagaa gaggccagtg aactcagcaa gctcaatgtc tcaaagagtg tgtgaggcag      4140
     cgccgagagc tgccaaggtg ctctgcgtgt ccaaacacag taacatctgt gtcgataggc      4200
     tgttgtgcta tctagcacct cagtttctgt ccccagatgt ggtgtcacgt ggtcatttca      4260
     gcccgaatct ctgtgtggag cacagttatt cagggttcat ttccacccat ttcggttttc      4320
     ctttacttgc gttcctggaa gccttttcct ggaagcctgc ccccagccca gccaggggat      4380
     ccagtcagca gcgtggaggg attcaagtgc cttcagggtc tggccttgcg tctggggctg      4440
     aggccactgg tggaatcatg gccctgggga ttatttgact tctttaag                   4488
//


spacer
spacer