spacer

EBI Dbfetch

ID   U28405; SV 1; linear; genomic DNA; STD; MUS; 1371 BP.
XX
AC   U28405;
XX
DT   04-JUL-1995 (Rel. 44, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 9)
XX
DE   Mus musculus macrophage inflammatory protein-1 alpha receptor-like 1 gene,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1263
RX   DOI; 10.1074/jbc.270.29.17494.
RX   PUBMED; 7542241.
RA   Gao J.L., Murphy P.M.;
RT   "Cloning and differential tissue-specific expression of three mouse beta
RT   chemokine receptor-like genes, including the gene for a functional
RT   macrophage inflammatory protein-1 alpha receptor";
RL   J Biol Chem 270(29):17494-17501(1995).
XX
RN   [2]
RP   1-1371
RA   Gao J.-L.;
RT   ;
RL   Submitted (05-JUN-1995) to the INSDC.
RL   Ji-Liang Gao, Lab of Host Defenses, NIAID, National Institutes of Health,
RL   Building 10, Room 11N113, Bethesda, MD 20892, USA
XX
DR   MD5; 04d944b81491d6c2d7269a24bdf04c13.
DR   Ensembl-Gn; ENSMUSG00000064039; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071404; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1371
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="lambda FIX 129/SvJ mouse genomic DNA library"
FT                   /db_xref="taxon:10090"
FT   CDS             193..1263
FT                   /codon_start=1
FT                   /gene="macrophage inflammatory protein-1 alpha
FT                   receptor-like 1 gene"
FT                   /note="MIP-1 alpha receptor like-1"
FT                   /db_xref="GOA:P51676"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR002236"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:104617"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51676"
FT                   /protein_id="AAA89154.1"
FT                   /translation="MEIPAVTEPSYNTVAKNDFMSGFLCFSINVRAFGITVPTPLYSLV
FT                   FIIGVIGHVLVVLVLIQHKRLRNMTSIYLFNLAISDLVFLSTLPFWVDYIMKGDWIFGN
FT                   AMCKFVSGFYYLGLYSDMFFITLLTIDRYLAVVHVVFALRARTVTFGIISSIITWVLAA
FT                   LVSIPCLYVFKSQMEFTYHTCRAILPRKSLIRFLRFQALTMNILGLILPLLAMIICYTR
FT                   IINVLHRRPNKKKAKVMRLIFVITLLFFLLLAPYYLAAFVSAFEDVLFTPSCLRSQQVD
FT                   LSLMITEALAYTHCCVNPVIYVFVGKRFRKYLWQLFRRHTAITLPQWLPFLSEDRAQRA
FT                   SARLPSTVEIETSADL"
XX
SQ   Sequence 1371 BP; 336 A; 321 C; 294 G; 420 T; 0 other;
     gggtagaaag gatgtgaaca gtccttttta ccatttcaac ttcagggttt agtaaactct        60
     aggcactagt aaatagttca attggttgaa gaaatataag catttccttg tctttgtttt       120
     ttcagagccc tacgtgttta atagcaaagc aaatataaag gtcattgtcc ctgtcctgta       180
     gaagagttta caatggagat tccagctgtc acagagccct cctacaacac agttgccaag       240
     aatgacttca tgtctggatt cttatgcttc agcataaatg tgagggcatt tggaatcaca       300
     gtgccgactc ccctgtactc cctggtgttc atcattggcg tgataggcca tgtcttggtg       360
     gttctggtgc tcatacaaca caagaggctt cgaaacatga ccagcatcta cctgttcaac       420
     ctggctatct ctgatctggt cttcctctcc acattacctt tctgggttga ctatatcatg       480
     aaaggagact ggatttttgg taacgccatg tgtaagtttg tgtctggatt ttattacctg       540
     ggcttgtata gtgacatgtt tttcatcacc ctgcttacga ttgatagata cctagctgtt       600
     gtccatgtcg tgtttgccct gagagcccgg actgtcactt ttggcatcat cagtagcatc       660
     attacctggg tcctggctgc cttggtttct attccttgtc tctatgtttt caaatcccag       720
     atggagttca cttaccatac ctgcagagca attttgccca ggaagagcct gatacgtttt       780
     ttaaggtttc aggctctaac aatgaacatc cttgggctaa ttttgcctct gttggccatg       840
     attatctgct acacacggat catcaatgtt ttacacagaa gacccaataa gaagaaggcc       900
     aaagtcatgc gcctgatttt tgttattacg cttctcttct tcctcctctt ggccccttat       960
     tatctggctg cctttgtttc tgcttttgaa gacgtcctat tcacccctag ttgtttgaga      1020
     agccaacagg tggacctgtc cttgatgata actgaagcac ttgcctacac ccactgctgt      1080
     gtcaacccag tcatttatgt ctttgtgggt aaacggttcc ggaagtacct ctggcagttg      1140
     tttcggaggc atacagctat aaccctgcca caatggctgc cctttctctc ggaggacaga      1200
     gcacagaggg ccagtgcacg cctcccatcc acagtggaaa ttgagacctc tgccgactta      1260
     taattcagac cctggacaga acaaaggcct agaagagtga aaagacagtg tgcctctcca      1320
     agacgatata ggaggatcat gaaacgagga ataaacttac agttgacttg a               1371
//


spacer
spacer